KEGG   Salinibacter ruber M8: SRM_03011Help
Entry
SRM_03011         CDS       T01209                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
srm  Salinibacter ruber M8
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:srm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3525060..3525716
Genome map
AA seq 218 aa AA seqDB search
MAEKKIQSSGLRTNGSADGMPPKLYERRDIYDEETSEALSEHIEAILDILGEDADREGLA
DTPERVARAYQFLMHGYALDPKDILRQALFEEAYDEMILVKDIEVYSMCEHHMLPFYGKA
HVAYIPDGQIVGLSKIPRTVEVFARRLQVQERLTLQIRNAIDEVVDPMGTAVVIEAKHLC
MMMRGAEKQNSATTTSSVSGEFNNHATRDEFMRLIDAE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaaaagatccaatcgagcgggctgcgcaccaacggctccgccgacggcatg
ccgccgaaactctacgagcggcgcgacatctacgacgaagagacctccgaggccctcagc
gagcacatcgaggccatcctcgacatcctgggcgaagacgcagaccgggaggggctcgcc
gacacccccgagcgcgtcgcccgcgcctatcagtttttgatgcacgggtacgccctcgac
ccgaaggacatcctgcgccaggccctcttcgaagaggcctacgacgagatgattctcgtc
aaggacatcgaggtgtactcgatgtgcgagcaccacatgctgccgttttacggaaaggcc
catgtggcctacatcccggacggccagattgtgggactcagcaaaatcccgcggacggtc
gaggtcttcgcccggcgcctgcaggtgcaggagcgccttacgctccagatccgaaacgcc
atcgacgaggtggtcgaccccatgggtacggctgtcgtcatcgaggcgaagcacctctgc
atgatgatgcggggggccgaaaagcagaactcggcgaccaccaccagctcggtgagcggc
gagtttaacaatcacgccacccgggacgagttcatgcgcttgatcgacgccgagtag

DBGET integrated database retrieval system