KEGG   Streptosporangium roseum: Sros_0353Help
Entry
Sros_0353         CDS       T01137                                 

Definition
Xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sro  Streptosporangium roseum
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sros_0353
   00051 Fructose and mannose metabolism
    Sros_0353
Enzymes [BR:sro01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Sros_0353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
340472..341623
Genome map
AA seq 383 aa AA seqDB search
MSDYTPKPEDRFTFGLWTVGWQARDQFGDASRAPLDPVESVHRLAELGAYGVTFHDDDLL
AVEPDRDKAVERFKKALAETGLKVPMATTNLFTHPVFKDGGFTSNDRDVRRYALRKVMRN
VDLAAELGATTYVCWGGREGAESGAAKDIRAALSRYKEGMDLLTSYVIDRGYDIRFAIEP
KPNEPRGDILLPTVGHALAFINELEHSERVGLNPEVGHEEMAGLNFAHGIAQALWHGKLF
HIDLNGQHGPRFDQDLVFGHGDVKNSFFLVDLLENGGYDGPRHFDYKPLRTEDAEDVWVS
AAANMRTYLILKEKVKAFHADPEVVEARAASRVAELSEPTLAPGETLEDLHRDDFDVDRA
AARGFHFSRLNQLALEHLLGVRG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagcgactacacgcccaagcctgaggaccgcttcaccttcgggctgtggaccgtcggc
tggcaggcccgtgaccagttcggagacgcgagccgtgccccgctcgacccggtggagagc
gtccaccgcctcgccgagctcggcgcgtacggcgtcaccttccacgacgacgacctgctg
gccgtcgagccggaccgggacaaggccgtcgagcgtttcaagaaggccctggccgagacc
ggcctcaaggtccccatggccaccacgaacctgttcacccaccccgtcttcaaggacggc
gggttcaccagcaacgaccgcgacgtgcgccgctacgccctgcgcaaggtgatgcgcaac
gtcgacctggcagccgagctcggcgcgaccacctacgtctgctggggcggccgcgagggc
gccgagtcaggggccgccaaggacatcagggccgcgctcagccgttacaaggagggcatg
gacctgctgacctcctacgtgatcgaccggggctacgacatcaggttcgccatcgagccc
aagccgaacgagccgcgcggcgacatcctgctcccgaccgtcggccacgcgctcgccttc
atcaacgagctggagcactccgagcgggtcggcctcaacccggaggtcggccacgaggag
atggccgggctcaacttcgcgcacggcatcgcgcaggcgctctggcacggcaagctcttc
cacatcgacctcaacggccagcacggcccccggttcgaccaggacctcgtcttcggccac
ggcgacgtgaagaactccttcttcctggtggacctgctggagaacggcggctacgacggc
ccccggcacttcgactacaagccgctgcgcaccgaggacgccgaggacgtctgggtctcg
gccgcggccaacatgcgcacctacctgatcctcaaggagaaggtgaaggccttccacgcc
gaccccgaggtcgtcgaggcgcgcgccgccagcagggtcgccgagctgtccgagcccacg
ctggcccccggtgagacgcttgaggacctgcaccgcgacgacttcgacgtcgaccgggcc
gccgcgcgaggcttccacttctcccggctgaaccagctcgccctggagcacctcctcgga
gtccggggatga

DBGET integrated database retrieval system