KEGG   Streptosporangium roseum: Sros_0365Help
Entry
Sros_0365         CDS       T01137                                 

Definition
hypothetical protein
Orthology
K00316  
spermidine dehydrogenase [EC:1.5.99.6]
Organism
sro  Streptosporangium roseum
Pathway
Arginine and proline metabolism
beta-Alanine metabolism
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sro00330]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:sro00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(353115..355049)
Genome map
AA seq 644 aa AA seqDB search
MDRPISRRDFFDGVATVAGVAALGSLAGCAGPGAGRPNTIGTKNLKVPSETNYPPVLTGM
QGNTSNALSVPHALRDGRFWDHAGAPEPTGEHYDLVVVGAGISGVAAAHRWLERAPDARI
LILDNHDEVGGHARRNEFHPAGRKGPLIGYGGSQSIDAPSAWTPEGKDLLDKIGVRVRRF
EEYFDQTLYTGMRMYGSVFCDRETFPREKLVVFTPGRKAPEWIAELPVAEQAREDLLMLY
GHPPDWFPGLSDGLKKERLAGLTYAEFLRDVCKVHPDVLRYVQTMPNDEWGYGSDAFGAI
DAWGSAGEHDYPGFQGLELDRATPSEYNSPSMIKGWGADDPYVYHFPEGNQAIVRMMIGR
MIPGFATSTEMEEISTATFDYGRLDLPRNQIRIRLSCPVVSAANDGDPATATTATVGYFD
GDRVRTVRAANVIMACWNMVIPYLVGELPADQKDALSKAVKVPLLYAMVQLRGWEAWKRA
GISRTRFTGAYWCGAELDYPVSIGEYLRPKTPDQPINVHMISTPALPGMSPASGSVAGRH
ELIKTPYEYLEYSIRDQLTRLLGPSGFDPARDIQAITVNRWGHGYAPEYATPWNLDFYPH
GPFPATVARRRAGRIAIANSDSVPAAYADAAITAAYRAVGELQA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggaccggcccatctcccgccgtgacttcttcgacggcgtggccacggtggcgggggtc
gcggcgctgggctcgctggcggggtgcgccggccccggcgcgggccggccgaacaccatc
ggcacgaagaacctgaaggtcccgtccgagaccaactatccaccggtcctcacggggatg
cagggcaacacctcgaacgcgctgagcgtgccccacgccctccgcgacggccggttctgg
gaccacgcgggggcgcccgaacccaccggcgagcactacgacctggtcgtggtcggcgcg
ggcatcagcggcgtcgccgcggcccaccgctggctggagcgcgccccggacgcgcggatc
ctgatcctggacaaccacgacgaggtcggcgggcacgcccggcgcaacgagttccacccg
gcgggccgcaaggggccgctgatcgggtacggcggatcgcagtcgatcgacgccccctcg
gcgtggacccccgaggggaaggacctgctcgacaagatcggggtgagggtccgcaggttc
gaggagtacttcgatcagacgctctacaccggcatgaggatgtacggcagcgtcttctgc
gaccgggagaccttcccccgggagaagctcgtcgtcttcaccccgggcaggaaggccccg
gagtggatcgccgaactgcccgtcgccgagcaggccagggaggacctgctcatgctctac
gggcatccgccggactggttccccggcctgtccgacggcctgaagaaggaacgcctggcc
gggctgacctacgcggagttcctcagggacgtctgcaaggtccaccctgacgtgctgcgg
tacgtccagaccatgccgaacgacgagtggggctacggctccgacgccttcggcgcgatc
gacgcctggggcagcgccggcgagcacgactaccccggattccaggggctggagctcgac
cgcgccacgccgtccgagtacaactcgccgagcatgatcaaggggtggggcgcggacgac
ccgtacgtctaccacttccccgagggcaaccaggcgatcgtccggatgatgatcggccgg
atgatcccgggcttcgccacgtccaccgagatggaggagatcagcaccgcgacgttcgac
tacggcaggctcgacctgccgcgcaaccagatccggatccgcctgtcctgcccggtggtc
tcggccgccaacgacggcgaccccgccacggccaccaccgccacggtcggctacttcgac
ggggatagggtcaggaccgtccgggcggccaacgtgatcatggcctgctggaacatggtg
atcccctacctggtcggcgagcttcctgccgaccagaaggacgcgctgagcaaggcggtc
aaggtgccgctgctgtacgcgatggtccagctccgcggctgggaggcctggaagcgggcg
ggcatcagccgtacccgcttcaccggcgcctactggtgcggggccgagcttgactacccg
gtgagcatcggggagtatctgcgcccgaagaccccggaccagccgatcaacgtgcacatg
atctccactcccgcgctgccgggcatgtcacccgccagcggttcggtcgccgggcgtcac
gagctgatcaagacgccctacgagtacctggagtacagcatccgcgaccagctcacccgg
ctcctcggcccgagcggattcgacccggcccgcgacatccaggcgatcacggtcaaccgg
tggggccacggctacgcgcccgagtacgccactccgtggaacctcgacttctacccccac
gggccgttccccgcgaccgtggcccgccggcgggccggccggatcgcgatcgccaactcc
gactcggtgccggccgcctacgccgacgcggcgatcaccgccgcctaccgcgcggtcggg
gagctccaggcgtaa

DBGET integrated database retrieval system