KEGG   Streptosporangium roseum: Sros_0372Help
Entry
Sros_0372         CDS       T01137                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
sro  Streptosporangium roseum
Pathway
sro00010  Glycolysis / Gluconeogenesis
sro00071  Fatty acid degradation
sro00350  Tyrosine metabolism
sro00625  Chloroalkane and chloroalkene degradation
sro00626  Naphthalene degradation
sro01100  Metabolic pathways
sro01110  Biosynthesis of secondary metabolites
sro01120  Microbial metabolism in diverse environments
sro01130  Biosynthesis of antibiotics
sro01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sros_0372
  Lipid metabolism
   00071 Fatty acid degradation
    Sros_0372
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sros_0372
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sros_0372
   00626 Naphthalene degradation
    Sros_0372
Enzymes [BR:sro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sros_0372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C NAD_binding_10 2-Hacid_dh_C NAD_binding_2 NifU
Motif
Other DBs
NCBI-ProteinID: ACZ83403
UniProt: D2B0Z6
Position
complement(360663..361691)
Genome map
AA seq 342 aa AA seqDB search
MSSSAMHRAMQVAEPGGDLSLVRVDTQEPAPGQVRVTVEACGVCHSDALITGGHIPGTTF
PVTTGHEIAGRIDAIGGNVTGWSVGDRVAVGWYGGSCGHCDACREGDGVLCPELQVPGVA
YAGGFADSVVVPAVALASVPDELTAAEAAPLACAGVTVYNALRRSSARPGDTVAVLGLGG
LGHLGVQFAAKMGFNTVAMARGPEKASLAHKLGASHYIDSATEKTADALQAHGGAKVVLA
TVTDAAAMSATVDGLGRHGELIIVGVAMEPMDITPLQLVSGAKRVYGHASGIAVDTQNTM
RFAAQSGVRSWTEEVPLEEADAAFQKMISGQARFRMVLTTGN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcttctgctatgcaccgtgccatgcaggtcgccgagcctggcggggacctgtct
ctggttcgggtggatacccaggagccggccccgggccaggtacgggtcaccgtcgaggcg
tgtggggtgtgccactccgacgcgttgatcaccggcggacacatcccgggcaccaccttt
cccgtcacgacagggcacgagatcgcgggacgcatcgacgcgatcggcggcaacgtcacc
ggctggtcagtcggtgatcgggtggcggtcggctggtacggaggtagttgcggccactgc
gacgcctgcagggaaggcgacggcgtcctctgccccgagcttcaggtgccgggagtcgcg
tacgccggagggttcgctgactccgtcgtggtgccggccgtcgccctggcctcggtcccg
gacgagctgacggcggcggaggccgcgcccctggcctgcgccggcgtgaccgtgtacaac
gcgctgcgccgcagctccgcgcgtccaggcgacaccgttgcggttctcggtctgggcggc
ctggggcacctgggcgttcagttcgccgcgaagatgggcttcaataccgtcgcgatggcc
cgcggtcccgaaaaggcgtcgctggctcacaagctcggcgcgtctcactatatcgacagc
gccaccgagaagacggccgacgcgctgcaggcccacgggggagccaaggtggtgttggcg
acggtgaccgacgccgcggcgatgtccgcgacggtcgacgggttggggcgccacggcgag
ctcatcatcgtcggcgtcgccatggagccgatggacatcacgcccctgcagctcgtgagc
ggggccaagcgggtgtacgggcacgcttccggcatcgcggtcgacacccagaacaccatg
aggttcgccgcccagagcggcgtccggtcgtggaccgaggaggttccgctggaggaagcc
gatgcggcgttccagaagatgatctccggccaggcccgcttccgcatggtcctcaccacc
ggtaactga

DBGET integrated database retrieval system