KEGG   Streptosporangium roseum: Sros_0551Help
Entry
Sros_0551         CDS       T01137                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sro  Streptosporangium roseum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sros_0551
Enzymes [BR:sro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Sros_0551
Exosome [BR:sro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sros_0551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
557690..558676
Genome map
AA seq 328 aa AA seqDB search
MSAQFPIARPRRLRRMAAMRRMVAGTRLHPAELVLPLFVKEGIGEPNPIGSMPGVFQHTR
DSLRKAAHEAAEAGVGGLILFGIPAVKDARGSAADDPDGIVQQAVADVVADVGDALVVMT
DTCLDEFTDHGHCGILTPGGEVDNDATLERYAAAAVSQARAGSQVIAPSGMMDGQVAAIR
AGLDADGFEQIPILAYAVKYASAFYGPFREAAECAPQFGDRNAYQQDAAGPVGEALREVR
LDLDEGADWVMVKPALAYLDILRQVRDAVDVPVAAYQVSGEYAMIEAAAANGWIDRDRAI
MESLVAIRRAGADMILTYWATEVAKKLQ
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctcagttccccatcgcgcgtccgcgcaggctccgccgtatggcggcgatgcgc
cgtatggtcgccggtacccgactgcacccggcggagctggtgctgccgctgttcgtcaag
gagggcatcggcgagccgaacccgatcggctcgatgcccggggtgttccagcacacccgt
gactcgctgcgcaaggccgcccatgaggcggccgaggcgggggtcggcgggctcatcctg
ttcggcatacccgcggtgaaggacgcgcgggggtcggcggccgacgaccctgacgggatc
gtccagcaggccgtcgccgacgtggtcgccgacgtgggcgacgcgctggtcgtgatgacc
gacacctgcctggacgagttcaccgaccacgggcactgcggcatcctgacgcccggcggc
gaggtcgacaacgacgccaccctggagcgttacgcggccgccgcggtgtcccaggcccgc
gccgggtcgcaggtcatcgcgcccagcggcatgatggacggccaggtcgccgcgatccgc
gcggggctggacgccgacggcttcgagcagatcccgatcctcgcctacgcggtcaagtac
gcctcggcgttctacgggccgttccgggaggcggccgagtgcgccccgcagttcggcgac
cgcaacgcctaccagcaggacgcggcgggcccggtcggcgaggcgctgcgcgaggtgcgg
ctggacctcgacgagggcgccgactgggtgatggtcaagcccgcgctggcctacctcgac
atcctgcgccaggtgcgtgacgcggtggacgtgccggtggccgcctaccaggtcagcggg
gagtacgccatgatcgaggccgcggcggcgaacggctggatcgaccgggaccgggcgatc
atggagtcgctggtcgcgatccgccgggccggggccgacatgatcctcacctactgggcg
accgaggtggccaagaagctccagtga

DBGET integrated database retrieval system