KEGG   Streptosporangium roseum: Sros_0933Help
Entry
Sros_0933         CDS       T01137                                 

Definition
beta-1 4-xylanase-like protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
sro  Streptosporangium roseum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(948628..950259)
Genome map
AA seq 543 aa AA seqDB search
MPSLCRAISTGALAVLPIIAALLPAAPAHAADSLRDHAAARGKFIGAALATSPLAGEAAY
RTIAGAEFNQITAENAMKWDATEPSQNQFSWSAADAIVDFATQNGQQVHGHTLVWHSQTP
NWVQNLGADALRSAMRNHIAQVAGRYAANPAVVSWDVVNEVFDDSGNMRNSFWYQKLGDG
YIADAFRAARAADPDARLCINDYNVEGVNAKSTAMYNLVKSLRAQNVPVDCVGLQSHLAI
QYGFPGQVQQNMQRFADLGVEVRVTELDIRLQTPRDPAKDAQQATYYTNMVNACLAVSRC
SGITIWGFTDRYSWVPDTFPGQGAALIYDESYNPKPAYTAVHDALAGGGTPPDTTPPTAP
GTPAVSAITATGAKLTWTASTDNRAVTGYDVYSGTAKLGSSASNSLTLTGLSPQTAYTVH
IVARDAAGNLSTASGTAAFTTSAGQPGGACAATYKTVNSWQGGFQGEVTVTCTAAVTTWK
TTLTYPSGVTVPQSWNSTLSATPPTFTFTNAAWNGTVPAGGSTTFGFLGSWTGSGTPPTP
VIS
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcctctgcagagcgatctccaccggggcgctcgccgtactcccgatcatcgcg
gccctgctccccgccgccccggcccacgccgccgactccctgcgcgaccacgccgcggcg
cgcggcaagttcatcggcgccgcgctcgccacctctccccttgccggcgaggcggcctac
cgcaccatcgcgggcgccgagttcaaccagatcacggcggagaacgccatgaagtgggac
gccaccgaaccgagccagaaccagttcagctggtccgcggcggacgcgatcgtcgacttc
gccacgcagaacggccagcaggtgcacgggcacacgctggtctggcacagccagacgccg
aactgggtgcagaacctcggcgccgacgccctgcgctcggcgatgcgcaaccacatcgcc
caggtcgccggccgctacgccgccaacccggccgtcgtctcctgggacgtcgtgaacgag
gtcttcgacgacagcggcaacatgcgcaactcgttctggtaccagaaactgggtgacggc
tacatcgccgacgccttccgggccgcccgtgccgccgaccccgacgccaggctctgcatc
aacgactacaacgtcgagggcgtcaacgccaagagcacggcgatgtacaacctggtgaag
tcgctgcgggcgcagaacgtgccggtcgactgcgtgggcctccagagccacctggcgatc
cagtacggcttccccggccaggtccagcagaacatgcagcgcttcgccgacctcggcgtg
gaggtcagggtcaccgagctcgacatccggctgcagactccccgcgacccggcgaaggac
gcccagcaggccacctactacacgaacatggtcaacgcctgtctcgcggtgagccggtgc
tccggcatcacgatctggggcttcaccgacagatactcctgggtccccgacaccttcccc
ggccagggcgcggccctgatctacgacgagagctacaaccccaagcccgcctacacggcg
gtccacgacgccctggccggtggtggcaccccacccgacaccacgccgccgacggcgccg
ggcacacccgccgtgtcggccatcaccgccaccggcgccaagctgacctggaccgcctcg
accgacaaccgcgcggtcaccggctacgacgtctactccggcaccgccaagctcggctcc
tcggcgagcaactccctcaccctgaccggcctcagcccgcagaccgcctacaccgtccac
atcgtcgcccgcgacgccgcgggcaacctctccaccgcctccgggaccgcggccttcacc
acctccgccgggcagcccggcggtgcctgcgccgccacctacaagacggtcaactcctgg
cagggcggattccagggcgaggtcaccgtcacctgcaccgccgccgtcaccacctggaag
accaccctcacctatccctcgggcgtcaccgtcccccagtcctggaactccaccctctcg
gccaccccaccgaccttcaccttcaccaacgccgcctggaacggcaccgtccccgccggc
ggctcgaccaccttcggcttcctcggctcctggaccggctccggcaccccgcccaccccc
gtcatctcctag

DBGET integrated database retrieval system