KEGG   Streptosporangium roseum: Sros_0958Help
Entry
Sros_0958         CDS       T01137                                 

Definition
bisphosphoglycerate mutase (EC:5.4.2.4)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sro  Streptosporangium roseum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sros_0958
   01230 Biosynthesis of amino acids
    Sros_0958
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sros_0958
  Energy metabolism
   00680 Methane metabolism
    Sros_0958
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sros_0958
Enzymes [BR:sro01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Sros_0958
Exosome [BR:sro04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Sros_0958
  Exosomal proteins of melanoma cells
   Sros_0958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
977912..978655
Genome map
AA seq 247 aa AA seqDB search
MATLVLLRHGESEWNAKGLFTGWVDAGLSAKGEEEARRGGQLLLDAGVRPDVVHTSVLTR
AIQTANLALGAADLLWLPVTRSWRLNERHYGALQGKDKAQTRAEFGDEQFMLWRRSYDTP
PPPIADDDEFSQIGDQRYAALPDELLPRTECLKDVVERMLPYWYDQIVPDLSAGRTVLVV
AHGNSLRALVKHLDGIGDDEIAGLNIPTGIPLRYELDDDFRPVAKGGLYLDPEAAKAAIE
AVANQGK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggcgactttggtgctgctacggcatggtgagagcgagtggaacgctaagggtctgttc
accggatgggtggacgcggggctctcggccaagggcgaggaggaggcgcggcgcggcggg
caactgctgctcgacgccggggttcggcccgacgtggtccacacctcggtgctgacccgg
gccatccagaccgccaacctcgcgctcggcgccgccgatctgctctggctgccggtcacc
cgctcctggcggctcaacgagcgccactacggcgcgttgcagggcaaggacaaggcgcag
acgcgcgccgagttcggcgacgagcagttcatgctctggcgccgttcctacgacaccccg
ccgcccccgatcgccgacgacgacgagttctcgcagatcggcgaccagcgctacgcggcg
ctgccggacgagctgctgccgaggaccgagtgcctcaaggacgtcgtcgagcgcatgctg
ccgtactggtacgaccagatcgtgccggacctgtccgcgggcaggaccgtcctggtcgtc
gcgcacggcaactccctgcgcgcgctggtcaagcacctggacgggatcggcgacgacgag
atcgccgggctcaacatccccaccggcatcccgctccgctacgagctcgacgacgacttc
cggccggtcgccaagggcggcctgtatctcgaccccgaggccgccaaggcggcgatcgag
gccgtcgccaaccagggcaagtag

DBGET integrated database retrieval system