KEGG   Streptosporangium roseum: Sros_1243Help
Entry
Sros_1243         CDS       T01137                                 

Definition
succinate--CoA ligase (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sro  Streptosporangium roseum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sros_1243
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sros_1243
   00640 Propanoate metabolism
    Sros_1243
   00660 C5-Branched dibasic acid metabolism
    Sros_1243
Enzymes [BR:sro01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sros_1243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1275240..1276421
Genome map
AA seq 393 aa AA seqDB search
MDLFEHQAKELFAEYGIPVPRGVVAHTVEEARAAAEQLTGRVVVKAQVKTGGRGKAGGVK
VADDAADAEQKATQILGMDIKGHTVHKVLIEEASAIAEEYYFSFLLDRANRTFLAICSAA
GGMDIEEVAHSAPEKVAKIPVSPLDGVDRARAREIAEAGGLPVAALDGAAELIEKLWAAF
VDEDASLVEVNPMILSADGQVKALDGKVTLDDNAVFRQSDHVAFEDKDAEDPLEAAAKAK
DLNYVKLDGSVGIIGNGAGLVMSTLDVVAYAGEAFPGQPKPANFLDIGGGASAEVMAAGL
EIIISDPSVKSIFVNVFGGITACDAVANGIVSAFQLLESRGEAVSRPLVVRLDGNNAELG
RQILADAKLSGVELVDTMDDAAKRAAELAAVGA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgaacatcaggcgaaggagctcttcgcggagtacggcatcccggtgccg
cgtggcgttgtcgcgcacaccgtggaggaggcacgcgcggcagccgagcagctgaccggc
cgtgtcgtcgtcaaggcacaggtcaagaccggtggccgcggcaaggccggtggcgtcaag
gtcgccgacgacgccgccgacgccgagcagaaggccactcagatcctcggcatggacatc
aagggccacacggtccacaaggtcctgatcgaggaggccagcgcgatcgcggaggagtac
tacttctccttcctgctcgaccgcgcgaaccgtaccttcctcgccatctgctccgccgcg
ggcggcatggacatcgaagaggtcgcgcacagcgccccggagaaggtcgccaagatcccg
gtctccccgctggacggggtggaccgcgccagggcccgcgagatcgccgaggccggtggc
ctgccggtggccgcgctcgacggcgccgcggagctcatcgagaagctctgggccgccttc
gtcgacgaggacgcctccctggtcgaggtcaacccgatgatcctgtcggccgacggccag
gtgaaggccctcgacggcaaggtcaccctcgacgacaacgcggtcttccgccagtccgac
cacgtggccttcgaggacaaggacgcggaggaccctcttgaggccgcggccaaggcgaag
gacctcaactacgtcaagctcgacggcagcgtgggcatcatcggcaacggcgcgggcctg
gtcatgtcgaccctcgacgtcgtcgcctacgccggtgaggccttccccggccagcccaag
cccgccaacttcctcgacatcggcggcggcgcctcggccgaggtcatggccgccggcctg
gagatcatcatctccgacccgtccgtgaagtcgatcttcgtgaacgtcttcggcggcatc
accgcctgcgacgcggtcgccaacggcatcgtctccgccttccagctcctggagagccgc
ggcgaggccgtcagccgcccgctggtcgtccggctggacggcaacaacgccgaactcggg
cgtcagattctcgccgacgccaagctttccggcgtcgagctggtggacaccatggacgat
gcggccaagcgcgccgccgagctcgccgcggtaggtgcgtaa

DBGET integrated database retrieval system