KEGG   Streptosporangium roseum: Sros_1243Help
Entry
Sros_1243         CDS       T01137                                 

Definition
(GenBank) Succinate--CoA ligase (ADP-forming)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sro  Streptosporangium roseum
Pathway
sro00020  Citrate cycle (TCA cycle)
sro00640  Propanoate metabolism
sro00660  C5-Branched dibasic acid metabolism
sro01100  Metabolic pathways
sro01110  Biosynthesis of secondary metabolites
sro01120  Microbial metabolism in diverse environments
sro01130  Biosynthesis of antibiotics
sro01200  Carbon metabolism
Module
sro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sro_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sros_1243
   00640 Propanoate metabolism
    Sros_1243
   00660 C5-Branched dibasic acid metabolism
    Sros_1243
Enzymes [BR:sro01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sros_1243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 ATP-grasp ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ACZ84241
UniProt: D2BD00
Position
1275240..1276421
Genome map
AA seq 393 aa AA seqDB search
MDLFEHQAKELFAEYGIPVPRGVVAHTVEEARAAAEQLTGRVVVKAQVKTGGRGKAGGVK
VADDAADAEQKATQILGMDIKGHTVHKVLIEEASAIAEEYYFSFLLDRANRTFLAICSAA
GGMDIEEVAHSAPEKVAKIPVSPLDGVDRARAREIAEAGGLPVAALDGAAELIEKLWAAF
VDEDASLVEVNPMILSADGQVKALDGKVTLDDNAVFRQSDHVAFEDKDAEDPLEAAAKAK
DLNYVKLDGSVGIIGNGAGLVMSTLDVVAYAGEAFPGQPKPANFLDIGGGASAEVMAAGL
EIIISDPSVKSIFVNVFGGITACDAVANGIVSAFQLLESRGEAVSRPLVVRLDGNNAELG
RQILADAKLSGVELVDTMDDAAKRAAELAAVGA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgaacatcaggcgaaggagctcttcgcggagtacggcatcccggtgccg
cgtggcgttgtcgcgcacaccgtggaggaggcacgcgcggcagccgagcagctgaccggc
cgtgtcgtcgtcaaggcacaggtcaagaccggtggccgcggcaaggccggtggcgtcaag
gtcgccgacgacgccgccgacgccgagcagaaggccactcagatcctcggcatggacatc
aagggccacacggtccacaaggtcctgatcgaggaggccagcgcgatcgcggaggagtac
tacttctccttcctgctcgaccgcgcgaaccgtaccttcctcgccatctgctccgccgcg
ggcggcatggacatcgaagaggtcgcgcacagcgccccggagaaggtcgccaagatcccg
gtctccccgctggacggggtggaccgcgccagggcccgcgagatcgccgaggccggtggc
ctgccggtggccgcgctcgacggcgccgcggagctcatcgagaagctctgggccgccttc
gtcgacgaggacgcctccctggtcgaggtcaacccgatgatcctgtcggccgacggccag
gtgaaggccctcgacggcaaggtcaccctcgacgacaacgcggtcttccgccagtccgac
cacgtggccttcgaggacaaggacgcggaggaccctcttgaggccgcggccaaggcgaag
gacctcaactacgtcaagctcgacggcagcgtgggcatcatcggcaacggcgcgggcctg
gtcatgtcgaccctcgacgtcgtcgcctacgccggtgaggccttccccggccagcccaag
cccgccaacttcctcgacatcggcggcggcgcctcggccgaggtcatggccgccggcctg
gagatcatcatctccgacccgtccgtgaagtcgatcttcgtgaacgtcttcggcggcatc
accgcctgcgacgcggtcgccaacggcatcgtctccgccttccagctcctggagagccgc
ggcgaggccgtcagccgcccgctggtcgtccggctggacggcaacaacgccgaactcggg
cgtcagattctcgccgacgccaagctttccggcgtcgagctggtggacaccatggacgat
gcggccaagcgcgccgccgagctcgccgcggtaggtgcgtaa

DBGET integrated database retrieval system