KEGG   Streptosporangium roseum: Sros_1402Help
Entry
Sros_1402         CDS       T01137                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sro  Streptosporangium roseum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sros_1402
Enzymes [BR:sro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Sros_1402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1461965..1462921
Genome map
AA seq 318 aa AA seqDB search
MTVHGGDVEPVPPEDAHGRGGEDGARPYEMVVVGSVNADLVVRVDRRPAPGETVIGSDLV
THPGGKGANQAVAAARLGARVALLGRIGSDGHGEFLHKALAGDGVGLGHLVETPGPSGVA
LITVGADGDNSIIVSPGVNARLSEDDVAAAAGLLASARVVSLQLESPLAAVLAAARTAAR
VVFNLSPPAVVPDELLALCDPLVVNEHEAAFLLGGRGAPGSQARALLALGPRSVVLTLGA
GGAVVAEPGGVIEVPSPRVEAVDTTGAGDAFTGALAWRLAGGDDLATATAFAVRVGAASV
RRPGAQSSYPYPEDLEAL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtccacggcggcgacgtcgaacccgtccctcccgaggacgcccacgggcggggc
ggggaggacggggcacggccgtacgagatggtcgtcgtcggctcggtcaacgccgacctc
gtggtccgcgtcgaccgccgtcccgcgcccggcgagaccgtgatcggctccgacctggtc
acccatcccggggggaagggcgccaaccaggccgtcgccgcggcccggctcggcgcccgc
gtggccctgctcggcaggatcggctccgacggccacggcgagttcctgcacaaggcgctc
gccggcgacggcgtggggctgggccacctcgtcgagaccccggggccgagcggcgtcgcc
ctgatcaccgtgggggcggacggggacaacagcatcatcgtgtcaccgggggtcaacgcg
cggctgagcgaggacgacgtcgccgcggcggcaggcctgctggcctcggcgcgggtcgtc
tccctgcaactggagagcccgctcgccgcggtcctggccgccgcccggacggcggcgcgg
gtggtcttcaacctgtcgcctccggccgtggtccccgacgagctgctggcgctctgcgac
ccgctcgtcgtcaacgaacacgaggccgcgttcctgctcggggggcgcggcgcccccggc
tcgcaggcgcgggccctgctcgcgctcgggccccgctcggtggtcctcacattgggggcc
gggggcgcggtcgtcgccgagccgggcggggtgatcgaggtgccgagcccccgggtggag
gccgtcgacaccaccggcgccggtgacgcgttcaccggggcgctggcctggcgcctggcc
ggcggcgacgacctggccaccgccaccgccttcgcggtccgggtgggcgccgcctcggtg
cgcaggcccggcgcgcagagttcctatccgtacccggaggatctggaggccctgtga

DBGET integrated database retrieval system