KEGG   Streptosporangium roseum: Sros_1649Help
Entry
Sros_1649         CDS       T01137                                 

Definition
L-threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sro  Streptosporangium roseum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sros_1649
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sros_1649
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sros_1649
Enzymes [BR:sro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sros_1649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1762936..1763994
Genome map
AA seq 352 aa AA seqDB search
MTRAWRGLIEEYRDRLPVTTATPVVTLLEGGTPLVPARRVSALTGCDVFLKVEGANPTGS
FKDRGMTMAISKAVEDGAKAVICASTGNTSASAAAYAVRAGLTCAVLVPRGKIAMGKLAQ
ALVHGATLLQVEGSFDDCLEMTRKLSENYPIALVNSVNPFRLQGQKTAAFEIVDALGDAP
DIHCIPVGNAGNISAYWMGYTEYAADGVATRTPRMFGFQASGSAPIVNGAPVTHPHTIAT
AIRIGNPASWKLAEAARDESGGVIQAVTDRQIAAAYKLLAQEEGVFVELASAASVAGLLQ
AHAQGLVEPGRRIVCTVTGNGLKDPDWAISGAPTPVTIPIDAHAAATALGLA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaccagggcgtggcgtggcctcatcgaggagtaccgtgaccgacttccggtgaccacg
gcgacgcccgtcgtcacgctcctggagggcggcacgccgctcgtcccggcgcgccgggtc
tcggctctgaccggctgtgacgtcttcctcaaggtcgagggcgcgaacccgaccggcagc
ttcaaggaccgtggcatgaccatggccatcagcaaggccgtcgaggacggtgcgaaggcc
gtcatctgcgcctccaccggcaacaccagcgcctccgccgccgcctacgcggtccgcgcg
ggcctgacctgcgccgtgctggtgccccgcggcaagatcgcgatgggcaagctggcgcag
gcactggtccacggagccacgctgctccaggtcgagggctccttcgacgactgcctggag
atgaccaggaagctgtccgagaactaccccatcgcgctggtcaactcggtgaacccgttc
cggctccagggccagaagaccgcggccttcgagatcgtggacgcgctcggcgacgcgccc
gacatccactgcatcccggtcggaaacgcgggcaacatctcggcctactggatgggttac
accgaatacgccgcggacggcgtcgccaccaggacgccccgcatgttcggcttccaggcc
agcggctccgcgccgatcgtgaacggcgcgccggtgacccacccgcacacgatcgccacc
gcgatccgcatcggcaaccccgcctcctggaagctcgccgaggccgcccgggacgagtcc
ggcggcgtcatccaggccgtcaccgaccgccagatcgccgccgcgtacaagctgctggcc
caggaggagggcgtgttcgtcgagctcgcctccgccgccagcgtggccggcctcctccag
gcacacgcgcagggcctcgtcgagcccggccggcgcatcgtctgcacggtgaccggcaac
ggcctcaaggaccccgactgggccatctccggcgcgcccacgcccgtgacgatccccatc
gacgcccacgccgcggccacggcgctcggactcgcctga

DBGET integrated database retrieval system