KEGG   Streptosporangium roseum: Sros_1721Help
Entry
Sros_1721         CDS       T01137                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sro  Streptosporangium roseum
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Sros_1721
Enzymes [BR:sro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Sros_1721
    3.5.1.-  
     Sros_1721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1839607..1840179)
Genome map
AA seq 190 aa AA seqDB search
MATALIIVDVQNDFCEGGNLPVGGGAEVAAAISRHAASHDYDHVVATRDFHVDPGDHFAA
EPDYVSSWPTHCVAGTPGAEFHPAFDTAKVEEVFSKGTHAAAYSGFEGSAPDGTALADWL
ARRGVSTVDVVGIATDHCVRATALDAVGHGLAVQVLLDLTAGVARSTTDAALAALGAAGA
RLSGEPVVRG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgcactgatcatcgtcgatgtccagaacgacttctgcgagggcggcaacctg
ccggtgggcggcggcgccgaggtcgccgcggccatctcccggcacgccgcctcacacgac
tacgaccacgtcgtggccacccgtgacttccacgtcgaccccggcgaccacttcgccgcc
gagcccgactacgtgagctcctggcccacccactgcgtggccgggaccccgggcgcggag
ttccaccccgccttcgacaccgcgaaggtcgaggaggtcttcagcaagggcacccacgcc
gccgcctacagcggcttcgagggcagcgcccccgacggcacggcgctggccgactggctc
gcccggcgcggggtcagcacggtggacgtcgtcggcatcgccaccgaccactgcgtgcgc
gccaccgccctggacgcggtcggccacggcctggccgtacaggtgctgctggacctgacc
gccggggtggccaggtccaccacggacgccgcgctggccgcgctcggcgccgccggagcc
cggctcagcggcgagccggtggtccgcggctga

DBGET integrated database retrieval system