KEGG   Streptosporangium roseum: Sros_1877Help
Entry
Sros_1877         CDS       T01137                                 

Definition
guanidinobutyrase (EC:3.5.3.7)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sro  Streptosporangium roseum
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sro00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1993893..1994855
Genome map
AA seq 320 aa AA seqDB search
MTETRGPVDSSRIPRFAGPATFARLPRLDEVGRCDVAVVGVPFDSGVSYRPGARFGPSAV
REASRLLRPYHPGLDVSPFAALQVADAGDIACNPFDIGEAVETIEHAAGELQDTGARLVT
IGGDHTIALPLLRSLARRHGPVALLHFDAHLDTWDTYFGAEYTHGTPFRRAVEEGILDTE
ALSHVGTRGPLYGKKDLEDDRRLGFGVVTSADVMRRGVDEVVDALRQRIGGRPLYLSIDI
DVLDPAHAPGTGTPEAGGLTSRELLEILRGLAGANLVGADVVEVAPAYDHAEITSVAASH
VAYDLVSLLALSAPSLEKTP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagacccgggggcccgtcgactcctcccgcatcccgcgtttcgcgggcccggcc
accttcgcgcggctgccgcgtctggacgaggtcggccgctgcgacgtggccgtggtcgga
gtgcccttcgacagcggggtctcctaccggcccggcgcccgtttcggcccctcggccgtc
cgcgaggccagccgcctgctccggccgtaccacccgggcctggacgtctcgccgttcgcc
gcgctgcaggtggccgacgccggcgacatcgcctgcaacccgttcgacatcggcgaggcg
gtcgagacgatcgagcacgccgcgggcgagctccaggacaccggggctcggctggtgacg
atcggcggcgaccacacgatcgcgctgcccctgctccgctccctcgccaggaggcacggt
ccggtggcgctgctccacttcgacgcccacctcgacacctgggacacctacttcggcgcc
gagtacacccacggcacgccgttccgccgggccgtcgaggagggcattctcgacaccgag
gcgctcagtcacgtcggcacgcgcggcccgctgtacggcaagaaggacctcgaagacgac
aggcgcctgggcttcggcgtcgtgacctcggccgacgtgatgcgccggggtgtggacgag
gtcgtggacgcgctcaggcagcggatcggcggccgcccgctgtacctgtccatcgacatc
gacgtgctcgaccccgcgcacgcccccggcaccggcaccccggaggcgggcggcctgacc
agccgcgagctgctggagatcctgcgcggcctggccggggccaacctggtcggggccgac
gtggtcgaggtcgcccccgcctacgaccacgccgagatcacctcggtcgccgcctcccac
gtcgcctacgacctcgtcagcctgctggccctgtccgcgccctccctggagaagacccca
tga

DBGET integrated database retrieval system