KEGG   Streptosporangium roseum: Sros_1877Help
Entry
Sros_1877         CDS       T01137                                 

Definition
guanidinobutyrase (EC:3.5.3.7)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sro  Streptosporangium roseum
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sros_1877
Enzymes [BR:sro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Sros_1877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1993893..1994855
Genome map
AA seq 320 aa AA seqDB search
MTETRGPVDSSRIPRFAGPATFARLPRLDEVGRCDVAVVGVPFDSGVSYRPGARFGPSAV
REASRLLRPYHPGLDVSPFAALQVADAGDIACNPFDIGEAVETIEHAAGELQDTGARLVT
IGGDHTIALPLLRSLARRHGPVALLHFDAHLDTWDTYFGAEYTHGTPFRRAVEEGILDTE
ALSHVGTRGPLYGKKDLEDDRRLGFGVVTSADVMRRGVDEVVDALRQRIGGRPLYLSIDI
DVLDPAHAPGTGTPEAGGLTSRELLEILRGLAGANLVGADVVEVAPAYDHAEITSVAASH
VAYDLVSLLALSAPSLEKTP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagacccgggggcccgtcgactcctcccgcatcccgcgtttcgcgggcccggcc
accttcgcgcggctgccgcgtctggacgaggtcggccgctgcgacgtggccgtggtcgga
gtgcccttcgacagcggggtctcctaccggcccggcgcccgtttcggcccctcggccgtc
cgcgaggccagccgcctgctccggccgtaccacccgggcctggacgtctcgccgttcgcc
gcgctgcaggtggccgacgccggcgacatcgcctgcaacccgttcgacatcggcgaggcg
gtcgagacgatcgagcacgccgcgggcgagctccaggacaccggggctcggctggtgacg
atcggcggcgaccacacgatcgcgctgcccctgctccgctccctcgccaggaggcacggt
ccggtggcgctgctccacttcgacgcccacctcgacacctgggacacctacttcggcgcc
gagtacacccacggcacgccgttccgccgggccgtcgaggagggcattctcgacaccgag
gcgctcagtcacgtcggcacgcgcggcccgctgtacggcaagaaggacctcgaagacgac
aggcgcctgggcttcggcgtcgtgacctcggccgacgtgatgcgccggggtgtggacgag
gtcgtggacgcgctcaggcagcggatcggcggccgcccgctgtacctgtccatcgacatc
gacgtgctcgaccccgcgcacgcccccggcaccggcaccccggaggcgggcggcctgacc
agccgcgagctgctggagatcctgcgcggcctggccggggccaacctggtcggggccgac
gtggtcgaggtcgcccccgcctacgaccacgccgagatcacctcggtcgccgcctcccac
gtcgcctacgacctcgtcagcctgctggccctgtccgcgccctccctggagaagacccca
tga

DBGET integrated database retrieval system