KEGG   Streptosporangium roseum: Sros_1964Help
Entry
Sros_1964         CDS       T01137                                 

Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sro  Streptosporangium roseum
Pathway
sro00900  Terpenoid backbone biosynthesis
sro01100  Metabolic pathways
sro01110  Biosynthesis of secondary metabolites
sro01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sros_1964
Enzymes [BR:sro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Sros_1964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ACZ84952
UniProt: D2AVZ9
Position
2107795..2108979
Genome map
AA seq 394 aa AA seqDB search
MQSDTIRSVVLLGSTGSIGTQSLDVIARNPGRFRVAALAAGGGRVDLLARQAAEFRPDAV
AVADPSAVPALREALAARGVTARVLAGPEGVAEAAAWPSDTVLNGITGALGLTSTLAALE
AGRVLALANKESLIIGGPLVKRLAKPGQLLPVDSEHAALAQCLWAAGPTGPDASAVRRLI
VTASGGPFRGRSRAELTDVTPEQALAHPTWSMGPVITVNSATLVNKGLEVIEAHLLFDIG
FDRITVVVHPQSVVHSMVEFVDGSVIAQASPPDMRLPIALALGWPDRVAGAAPTVDWTRS
STWTFDPLDDEAFPAVALARQVGSAGGTAPAVYNAANEVCVEAFLAGRLPFLGIVDTVAA
VVSEHTVTRADSVEEVLDADGWARARARELTATA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgcagtcagacaccatccgctccgttgtcctgctcggctcgaccggctccatcgggacc
cagtccctcgacgtcatcgcccgcaaccccggccggttccgggtggcggcgctcgccgcc
ggaggcggccgggtcgacctgctggcccgccaggcggccgagttccggcccgacgcggtg
gccgtcgccgacccctcggcggtgcccgcgctgcgggaggccctggctgcgcgcggggtc
accgccagggtgctcgccgggccggagggggtcgccgaggccgccgcctggccgtccgac
acggtgctcaacggcatcaccggagcgctggggctgacctcgacgctggccgcgctggag
gcgggcagggtgctcgctctcgccaacaaggagtcgctgatcatcggcgggccgctggtg
aaacgcctggccaagccggggcagctcctcccggtcgactccgagcacgccgccctcgcc
cagtgcctgtgggccgcgggccccaccggccccgacgcgtcggccgtgcgccgcctgatc
gtcaccgcgagcggcggtcccttccggggcaggtcgcgagccgagctcacagacgtcacc
cccgagcaggccctggcccacccgacctggtcgatgggcccggtcatcaccgtgaactcc
gccacactcgtgaacaaggggctggaggtcatcgaggcccacctgctcttcgacatcggc
ttcgacaggatcaccgtcgtggtccacccgcagtcggtcgtccactccatggtggagttc
gtggacggctcggtcatcgcccaggcgagcccgcccgacatgaggctgcccatcgcgctg
gccctcggctggccggaccgggtcgccggagccgcccccacggtcgactggaccaggtcc
agcacctggactttcgaccccctcgacgacgaggccttccccgccgtcgcgctggcccgc
caggtcggctccgcgggcggtacggccccggcggtctacaacgccgccaatgaggtgtgc
gtcgaggcgttcctcgccggacggctgcccttcctgggtatcgtcgacaccgtggccgct
gtggtctccgagcacacggtgactcgggcggattccgtcgaagaggtgctcgacgccgac
ggatgggcacgggcgagggctcgggagctcaccgcgactgcctag

DBGET integrated database retrieval system