KEGG   Streptosporangium roseum: Sros_2061Help
Entry
Sros_2061         CDS       T01137                                 

Definition
beta-glucosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sro  Streptosporangium roseum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sro00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sro00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2214756..2216267
Genome map
AA seq 503 aa AA seqDB search
MKRGPELLRLADTVILPGFEGKTPPDWLRRRLAGGLTGVVLFSRNIATPSQVADLTAALR
AENPQVLVGIDEESGEVTRLEAAAGSTRPGSFALGVVDDLDLTEEIARDLGRDLAAAGVN
LDFAPSADVNSNPDNPVIGLRSFGADPDLVSRHTAAWVRGMQSSGVAACAKHFPGHGDTS
VDSHHGVPLVAATAEELHEVALRPFRAAIAEGVRTVMTGHLLVPAFDAAMPATLSGRVLH
DLLRVELGFDGVIVTDGIEMAAVSGTYGIGGASARAIAGGADAICVGGEHADEHTAIAVR
DAIVDAVIEGWLPEERLADAARRVCELALWGASTGHVRRSAPARPGDVPIGLVAARRALR
ITRRSASAVLPLPAPPHVVELAPEMNLAIEKDTPWGVGEPLGKLLPGTTVTRLSASTATG
GAIESALASAVDRPLVLVVRDAHRHPWQTDALNHLLAARPDTVVVEMGLPGRSDLGAVHI
ATHGSAKVCGQAAAEILAGDLRL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcggcccagagctgcttcgtctggcggacacggtgatccttccggggttcgag
ggcaagaccccgcccgactggctccgtcggcgtctcgccggcggtctgaccggggtggtg
ctcttctcccggaacatcgcgaccccgtcccaggtcgccgacctgacggccgcgctccgc
gcggagaacccgcaggtcctcgtcggcatcgacgaggagtcgggggaggtcacgcgcctg
gaggcggcggccgggagcacccggcccggcagcttcgctctcggcgtcgtcgacgacctc
gacctcaccgaggagatcgccagggacctcggccgcgacctcgccgcggcgggcgtcaac
ctcgacttcgccccctcggcggacgtcaactccaacccggacaatccggtcatcggcctg
cgttccttcggcgccgaccccgacctggtctcccggcacaccgccgcctgggtccggggc
atgcagtcctccggcgtcgccgcctgcgccaagcacttccccggccacggtgacacctcc
gtcgactcccaccacggcgtcccgctggtcgcggccaccgccgaggagctccacgaggtg
gcgctgcggcccttccgcgcggccatcgccgagggcgtgcgcacggtcatgaccggtcac
ctgctggtccccgccttcgacgccgcgatgcccgccacgctcagcggccgggtgctgcac
gacctgctccgggtcgagctgggcttcgacggcgtcatcgtcaccgacggcatcgagatg
gcggccgtctccggcacctacggcatcggcggcgcctcggcgcgggccatcgccgggggc
gccgacgcgatctgcgtgggcggcgagcacgccgacgagcacaccgccatcgcggtccgc
gacgccatcgtggacgccgtgatcgaggggtggctccccgaggagcggctggccgacgcg
gcccgccgggtctgtgagctggccctgtggggggcgtccacggggcacgtccgccgctcc
gcgcccgcccgccccggtgacgtcccgatcggcctggtcgccgcccggcgcgccctgcgg
atcacccgccgctccgcgtcggcggtcctcccgctgcccgctccgccccacgtggtcgag
ctcgccccggagatgaacctcgccatcgagaaggacaccccctggggcgtcggagagccg
ctcggcaagctcctccccggcaccacggtgacccgcctgagcgcctcgaccgccaccggg
ggcgcgatcgagtccgcgctcgcctccgcggtggaccgccccctggtcctcgtcgtccgc
gacgcccaccgccacccctggcagacggacgccctgaaccacctcctggccgcccggccg
gacaccgtcgtggtcgagatgggcctgcccggccgctccgacctcggcgccgtccacatc
gccacccacgggtcggccaaggtctgcggccaggccgccgccgagatcctcgccggggac
ctccggctctga

DBGET integrated database retrieval system