KEGG   Streptosporangium roseum: Sros_2065Help
Entry
Sros_2065         CDS       T01137                                 

Definition
(GenBank) putative enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sro  Streptosporangium roseum
Pathway
sro00071  Fatty acid degradation
sro00280  Valine, leucine and isoleucine degradation
sro00281  Geraniol degradation
sro00310  Lysine degradation
sro00360  Phenylalanine metabolism
sro00362  Benzoate degradation
sro00380  Tryptophan metabolism
sro00410  beta-Alanine metabolism
sro00627  Aminobenzoate degradation
sro00640  Propanoate metabolism
sro00650  Butanoate metabolism
sro00903  Limonene and pinene degradation
sro00930  Caprolactam degradation
sro01100  Metabolic pathways
sro01110  Biosynthesis of secondary metabolites
sro01120  Microbial metabolism in diverse environments
sro01130  Biosynthesis of antibiotics
sro01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sros_2065
   00650 Butanoate metabolism
    Sros_2065
  Lipid metabolism
   00071 Fatty acid degradation
    Sros_2065
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sros_2065
   00310 Lysine degradation
    Sros_2065
   00360 Phenylalanine metabolism
    Sros_2065
   00380 Tryptophan metabolism
    Sros_2065
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sros_2065
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sros_2065
   00281 Geraniol degradation
    Sros_2065
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sros_2065
   00627 Aminobenzoate degradation
    Sros_2065
   00930 Caprolactam degradation
    Sros_2065
Enzymes [BR:sro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sros_2065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACZ85050
UniProt: D2AW97
Position
complement(2219367..2220134)
Genome map
AA seq 255 aa AA seqDB search
MGITLHGGGPVAEVVVEVPPVNALTVSGWFELARAVREAGHDPGTRAVVLRAEGRGFNAG
VDVKEMQATPGHAALVGANRGCFAAFAAVYECEVPVIAAVHGFCLGGGVGLAGNADIVVA
SEDAYFGLPEVDRGALGAATHLARLVPQHLMRAMVYTCRNVTAAELHAFGSVLEVVPRDK
LRDAAFEVASVIAGKDPYVIRRAKESLNGIDPIDVRRSYRFEQGFTFELNLMGAGDRHRE
AFVSGTDGTPGEEAR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcactctgcatggcggcggaccggtcgccgaggtggtcgtggaggtgcccccg
gtcaacgcgttgaccgtctcgggctggttcgagctggcgcgggccgtgcgggaggccggg
cacgaccccggcacccgcgccgtggtgctgcgcgcggaggggcggggattcaacgccggg
gtggacgtcaaggagatgcaggccacccccgggcacgccgcgctggtcggggccaaccgg
gggtgcttcgcggcgttcgcggcggtgtacgagtgcgaggtccccgtgatcgccgccgtg
cacgggttctgcctggggggcggcgtcgggctggcgggcaacgccgacatcgtcgtggcc
agcgaggacgcctacttcggcctgccggaggtggaccgcggcgcgctgggcgcggccacc
catctggcccggctggtcccccagcacctgatgcgcgccatggtctacacctgccgcaac
gtcaccgccgccgagctgcacgccttcggctcggtgctggaggtcgtcccccgcgacaag
ctgcgcgacgccgccttcgaggtcgcctccgtgatcgccggcaaggacccctacgtcatc
cgccgggccaaggagtcgctgaacggcatcgacccgatcgacgtcaggcgcagctaccgg
ttcgagcagggcttcaccttcgagctcaacctgatgggcgccggcgacaggcaccgcgag
gcgttcgtctccgggacggacgggacaccgggcgaggaggcgcgatga

DBGET integrated database retrieval system