KEGG   Streptosporangium roseum: Sros_2191Help
Entry
Sros_2191         CDS       T01137                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sro  Streptosporangium roseum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sros_2191
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Sros_2191
Enzymes [BR:sro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sros_2191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2356051..2357505)
Genome map
AA seq 484 aa AA seqDB search
MSEFIADPSDRGLRRLAAGTLLVAFRGTTAPEWVLRDLENGLGGVTLFGFNVADPAQLSG
LTARLREAGEPVISLDEEGGDVTRLDYHVGSPYPGNAALGAVDDVELTRRVYRSIGDDLA
RCGVNLDMAPSADVNTADDNPVIGTRSFGPDTALVARHTVAAVHGLQAAGVAACVKHFPG
HGATRQDSHLEIPLVDASLELLRERELVPFRAAIDAGTRSIMTAHVRVPALTGTTPATLS
AAALTVLLRGELGYDGVIVSDALDMKAVTDTYGLAGGSVLSLAAGTDLLCLGPLPTEDDV
RRIITEIVAAVGDGRLPLARLEAAAERVARLRAWFGTSQTGQAEKNVIGLAAARRAVSLT
GSASPLVDPLVVEVDTPPTIAVGDVPWGFAPLLPQAEVVRVKPETADVPGILERATGRSL
VVVVKDAHRYEASKSVVSALLAARPDATVVEMGLPIWRPEGVTYLATYGAARANAQAAAE
LLGV
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagttcatcgcggaccccagcgatcgggggctgcgtcgtctcgcggccggcacg
ttgctcgtcgccttccggggcaccaccgcccccgaatgggtcctccgggacctggagaac
ggtcttggcggcgtcaccctcttcggcttcaacgtcgccgatcccgcccagctctccggc
ctcaccgcccgcctgcgcgaggccggtgaaccggtcatctctctggacgaggagggcggc
gacgtcacccggctcgactaccacgtgggcagcccctacccgggcaacgccgccctcggc
gccgtcgacgacgtcgagctgacccggcgcgtctaccggtccatcggtgacgacctggcc
cgctgtggcgtcaacctggacatggcgccgtccgccgacgtgaacaccgccgacgacaac
ccggtgatcggcacccgatccttcgggccggacaccgcgctggtcgcccggcacaccgtc
gccgccgtccacggcctgcaggcggcgggcgtggccgcctgcgtcaagcacttccccggt
cacggcgccacccgccaggactcccacctggagatcccgctcgtcgacgcctcgctcgaa
ctgctgcgggaacgcgagctcgtgcccttccgcgccgcgatcgacgccgggaccaggtcc
atcatgaccgcgcatgtccgggtccccgccctgaccggcacgacccccgccacgctgtcg
gccgccgccctgaccgtcctgctccgcggcgagctgggctacgacggcgtgatcgtctcc
gacgccctcgacatgaaggccgtcaccgacacctacggcctggccggcggctcggtgctc
tcgctcgccgccgggaccgacctgctctgcctcggcccactgccgaccgaggacgacgtc
cgccggatcatcaccgagatcgtcgccgcggtcggggacggccggctgccgctggcccgc
ctggaggccgccgccgagcgggtggcccgcctgcgcgcctggttcggcacgtcccagacg
ggccaggcggagaagaacgtcatcggcctggccgccgcccgccgcgcggtcagcctcacc
ggctcggcgtccccgctggtcgacccgctggtggtcgaggtggacaccccgccgaccatc
gcggtcggcgacgtgccgtggggcttcgcccccctgctgccgcaggcggaggtggtccgg
gtcaagcccgagacggcggacgtccccggcatcctggagcgtgccaccggccgttccctg
gtcgtcgtggtcaaggacgcccaccgctacgaggccagcaagtcggtggtgtcggcgctg
ctggccgcccgccccgacgccacggtggtcgagatgggcctgccgatctggcgccccgag
ggcgtcacctacctcgccacctacggcgccgcccgcgccaacgcccaggccgccgccgaa
ctgctcggcgtctga

DBGET integrated database retrieval system