KEGG   Streptosporangium roseum: Sros_2476Help
Entry
Sros_2476         CDS       T01137                                 

Definition
transcriptional regulator
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sro  Streptosporangium roseum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sros_2476
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sros_2476
   00052 Galactose metabolism
    Sros_2476
   00500 Starch and sucrose metabolism
    Sros_2476
   00520 Amino sugar and nucleotide sugar metabolism
    Sros_2476
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sros_2476
   00524 Butirosin and neomycin biosynthesis
    Sros_2476
Enzymes [BR:sro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sros_2476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2701683..2702774
Genome map
AA seq 363 aa AA seqDB search
MTLVVGVDIGGTKTSAGLVDSSGTLLAVRTLPTPAAQGPAAVLDTAAGLVGEVASGAGEV
TAVGVGSAGVVDPRRGVIVSATDAITGWAGTDLRGEVSRRLGLPVAVDNDVHAHALGEQW
RGAAAGYADVLLVAVGTGIGASVVLGGRVLRGAHSVAGHAGHVPAVAAAGRPCPCGGYGH
VEAVASGPAMLAEYRGRAAAAATEPSGAPEPAGVPGSAGAPEPAGVPGSAGVPGLAGAPG
SSGVTGPAAVSEPAAVSGSARVTGLADVARLAAEGDRIAVSVLTGGAAALGSTIGGLMNV
IDPEVVVVGGGVAACGELWWQALREGIAAEVLPALREVPVGPAALGGDAALLGAARMALE
VAG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctggtcgtcggcgtcgacatcggcggcacgaagacctccgccgggctggtcgac
tcctccggcaccctgctggccgtacggacgctgccgaccccggcggcgcaggggccggcc
gcggtcctggacaccgccgccggcctggtcggcgaggtcgcgtcaggggccggggaggtc
acggcggtaggcgtcggcagcgcgggggtggtcgatccgcggcgcggtgtgatcgtctcg
gccaccgatgccatcaccgggtgggcgggcaccgacctgcgcggcgaggtgtcccgcagg
ctcggcctgccggtcgcggtcgacaacgacgtgcacgcgcacgcgctcggcgagcagtgg
cgtggcgccgccgccggctacgccgacgtgctgctggtggccgtgggcaccgggatcggc
gcctccgtcgtcctcggcgggcgggtgctgcgcggcgcgcactccgtggccggtcacgcc
ggtcacgtgcccgccgtggcggcggccggccggccctgcccgtgtggcgggtacgggcac
gtcgaggcggtcgcgtccggccccgccatgctcgcggagtaccgcggccgcgccgcggcc
gcggcgacggaaccgtccggtgcgccggaaccggcgggtgtgccgggatcggcgggtgcg
ccggaaccggcgggtgtgccgggatcggcgggtgtgccgggactggccggtgcgcccgga
tcgtccggcgttacgggaccggccgccgtatcggaaccggccgctgtatcgggatcggcc
cgagtgacgggactggccgacgtcgcccggctcgccgcggagggcgaccggatcgccgtc
tccgtcctgaccgggggagcggcggcgctcggttcgacgatcggaggactcatgaacgtc
atcgatcccgaagtcgtggtggtcgggggaggcgtcgccgcgtgcggagagctgtggtgg
caggccctgcgcgaggggatcgccgccgaggtgctgcccgcgctgcgcgaggtgcccgtc
ggaccggccgcgctcggcggtgacgccgccctgctcggcgccgcccgaatggccctggag
gtggccggatga

DBGET integrated database retrieval system