KEGG   Streptosporangium roseum: Sros_2516Help
Entry
Sros_2516         CDS       T01137                                 

Definition
(GenBank) phosphoglycerate mutase
Organism
sro  Streptosporangium roseum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACZ85492
UniProt: D2B312
Position
complement(2747448..2748029)
Genome map
AA seq 193 aa AA seqDB search
MNEMILLRHGETEWSRDGRHTGRTDLPLTDKGDNQARALAPLVKGRTFDLALVSPALRAR
RTAELAGLTDYETDPDLWEWDYGGYEGITTPDIRETRPGWFLWRDGVIPGDTEHPGESAR
EVGARADRVIARARAADGDVVLVAHGHFLRVLCARWLALPPEDGRHFRLDTGTYSRLGYE
RDEPVILTWNAPV
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagatgattctgctgcggcacggcgagaccgagtggagccgggacggacgccac
accgggcgcaccgacctgccgctgaccgacaagggcgacaaccaggcgcgggcgctcgcc
ccgctggtcaagggccggacgttcgacctggccctggtcagccccgcgctgcgggcccgc
cggacggccgagctggccgggctcacggactacgagacagatcccgacctgtgggaatgg
gactacggcggctacgagggcatcaccaccccggacatccgcgagacccgccccggctgg
ttcctgtggcgggacggggtcatccccggcgacaccgagcaccccggggagagcgcgcgg
gaggtcggcgcccgcgccgaccgggtgatcgcgcgggcccgcgcggccgacggcgacgtg
gtgctggtcgcccacgggcacttcctgcgggtgctgtgcgcccgctggctcgccctgccc
ccggaggacggccgccacttccgcctggacaccggcacctactcccggctcggctacgaa
cgcgacgagccggtcatcctcacctggaacgcccccgtctga

DBGET integrated database retrieval system