KEGG   Streptosporangium roseum: Sros_2644Help
Entry
Sros_2644         CDS       T01137                                 

Definition
dihydrolipoyllysine-residue succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sro  Streptosporangium roseum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sros_2644
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sros_2644
  Amino acid metabolism
   00310 Lysine degradation
    Sros_2644
Enzymes [BR:sro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sros_2644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2877627..2879066)
Genome map
AA seq 479 aa AA seqDB search
MPKSVQMPQLGESVTEGTVTRWLKKEGERVEADEPLLEVSTDKVDTEIPSPTAGILTKIV
VAEDETVEVGAELAVIDENGSAGAAPAQEAAPEPEPEPAQPISSIPQPAPQAAAPAPEPA
PQAAPAPAAPQAPAPQAPAPQAQQAPAPQAAPAPVSGDSPYVTPLVRKLAGEHNVDLDAL
NGTGVGGRIRKQDVLEAARNQREQAAAQAPAPQAAAPQAPAQAAAPAQAPEPIAVDTTLR
GRTEKMSRLRQTIAKRMVESLQVSAQLTSVVEVDVTKIAQLRDRAKAEFQRREGVKLSFM
PFFALAAIEALKQHPKLNATINSETNEVTYFDAEHLGFATDTERGLLVPVIKDAGDLNIA
GLARKIADLAERTRTNKVSPDELGGGTFTLTNTGSRGALFDTPILNQPQVGMLGTGAVVK
RPVVLDTAEGEVIAVRSMVYLALSYDHRLVDGADAARFLTTIKRRLEEGRFENQLGLNA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagtccgtacagatgccccagctcggcgagagcgtcaccgagggcaccgtcacc
cgttggctgaagaaggagggcgagcgcgtcgaggccgacgagccgctcctcgaagtctcc
accgacaaggtcgacaccgagatcccctcgccgacggcgggcattctcaccaagatcgtc
gtcgccgaggacgagaccgtcgaggtcggcgccgagctggccgtcatcgacgagaacggc
tccgcgggcgccgctccggcccaggaggccgctcccgagcccgagcccgagccggcccag
ccgatctcctcgatcccgcagcccgccccgcaggccgccgctccggcccccgagccggca
ccgcaggccgctccggccccggcggccccgcaggctccggccccgcaggctccggcgccg
caggcccagcaggctccggcgcctcaggccgctccggcaccggtctccggtgacagcccg
tacgtcaccccgctggtccgcaagctcgccggcgagcacaacgtcgacctggacgcgctg
aacggcaccggcgtcggtggccgcatccgcaagcaggacgtgctggaggccgcccgcaac
cagcgcgagcaggccgccgcccaggctccggccccgcaggccgccgccccgcaggctccg
gcccaggcggccgcccccgcccaggcccccgagccgatcgcggtggacaccacgctgcgt
ggccgtaccgagaagatgtcgcgcctgcgtcagaccatcgccaagcgcatggtcgagtcg
ctgcaggtctcggctcagctcacctcggtggtcgaggtcgacgtcaccaagatcgcgcag
ctgcgcgaccgggcgaaggccgagttccagcggcgcgagggcgtcaagctctcgttcatg
ccgttcttcgccctggccgcgatcgaggcgctcaagcagcacccgaagctgaacgccacg
atcaacagcgagaccaacgaggtcacctacttcgacgccgagcacctcggcttcgcgacg
gacaccgagcgcggcctgctcgtcccggtgatcaaggacgcgggcgacctcaacatcgcc
ggcctggcccgcaagatcgccgacctggccgagcgcacccgcaccaacaaggtgagcccg
gacgagctcggcggcggcacgttcacgctgaccaacaccggcagccgcggcgcgctgttc
gacacgccgatcctcaaccagccgcaggtcggcatgctgggcaccggcgcggtcgtcaag
cgcccggtggtcctggacaccgccgagggtgaggtcatcgccgtccgctcgatggtgtac
ctcgcgctcagctacgaccaccgcctggtcgacggcgccgacgccgcccgcttcctgacg
acgatcaagcgtcgtctcgaggagggccgcttcgagaaccagctgggcctcaacgcctag

DBGET integrated database retrieval system