KEGG   Streptosporangium roseum: Sros_2701Help
Entry
Sros_2701         CDS       T01137                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sro  Streptosporangium roseum
Pathway
sro00010  Glycolysis / Gluconeogenesis
sro00052  Galactose metabolism
sro00500  Starch and sucrose metabolism
sro00520  Amino sugar and nucleotide sugar metabolism
sro00521  Streptomycin biosynthesis
sro01100  Metabolic pathways
sro01110  Biosynthesis of secondary metabolites
sro01120  Microbial metabolism in diverse environments
sro01130  Biosynthesis of antibiotics
sro01200  Carbon metabolism
Module
sro_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sros_2701
   00052 Galactose metabolism
    Sros_2701
   00500 Starch and sucrose metabolism
    Sros_2701
   00520 Amino sugar and nucleotide sugar metabolism
    Sros_2701
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sros_2701
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Sros_2701
Enzymes [BR:sro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sros_2701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG SpoVS Hydant_A_N FGGY_N
Motif
Other DBs
NCBI-ProteinID: ACZ85666
UniProt: D2B4Y0
Position
2937973..2938917
Genome map
AA seq 314 aa AA seqDB search
MALTIGVDIGGTKVAAGVVDDDGHIVEHLLRPTPATNPEQVAETIAEAVRELSKGREIEA
VGLGAAGFVDETRSVVRFAPNLAWREEPLQKKVSDLVGLPVVVENDANAMAWGEAKFGAG
RDESHLVCVTIGTGIGGGIVLDGALYRGRWGMGAELGHMQVVPEGRLCGCGNLGCWEQYA
SGNALVAEARAIAEADPARAAVLLKIAGGTPEHVEGHEVTEAAKQGDPAALAAFSAMAEW
LAQGLCDLAAVLDPGCFVLGGGVSRAADLWIDQVREAFARNLTGRGHRPLADIRLAELGA
SAGLVGAADLARRR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaccatcggcgttgacatcggcggtaccaaggtcgcggcgggcgtcgtggac
gacgacggccacatcgtcgagcaccttctgcggcccaccccggccaccaaccccgaacag
gtcgccgagacgatcgccgaggcggtccgggagctgtccaagggccgggagatcgaggcc
gtcggcctcggcgccgccggattcgtcgacgagacccggtccgtcgtgcgcttcgcgccc
aacctcgcctggcgcgaggagccgctgcagaagaaggtctccgacctcgtcggcctgccc
gtcgtggtggagaacgacgccaacgcgatggcgtggggcgaggccaagttcggcgccggg
cgcgatgagagccatctcgtctgcgtgaccatcggcaccggcatcggcggcgggatcgtg
ctggacggcgccctctaccgtggccgctggggcatgggcgccgagctgggccacatgcag
gtggtgccggagggtcgcctgtgcgggtgcggcaacctcggctgctgggagcagtacgcc
agtggcaacgccctggtcgccgaggccagggcgatcgccgaggccgacccggcacgtgcc
gccgtgctgctgaagatcgccggtggcacccccgagcacgtcgagggccacgaggtcacc
gaggcggccaagcagggagacccggccgcgctggccgcgttctccgcgatggccgagtgg
ctcgcccagggcctgtgcgacctcgccgcggtcctcgaccccgggtgcttcgtcctcggc
ggcggcgtctcccgcgccgccgacctctggatcgaccaggtccgtgaggccttcgcccgc
aacctgaccggccgggggcaccgtcccctggccgacatccgcctggccgagctgggcgcg
tcggccggcctggtcggcgcggcggacctcgcgcgcaggcgctga

DBGET integrated database retrieval system