KEGG   Streptosporangium roseum: Sros_2705Help
Entry
Sros_2705         CDS       T01137                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sro  Streptosporangium roseum
Brite
Enzymes [BR:sro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Sros_2705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2941553..2942317)
Genome map
AA seq 254 aa AA seqDB search
MPVMPGAEPYHHKGGQIGVLLCHGFTGSPQSLRPWGEHLAAAGLTVALPRLPGHGTTWQE
MNRTRWEDWYAELDRTLADLRGRCTEIFVMGLSMGGCMALRLAQVHGAGIRGLVIVNPSV
TSDVPLLRLAPLLGLVVPSVPGVAGDIKKEGAIELGYTRTPVRAAASLTRLWALTQAELG
KVTQPVLVFHSPQDHVVKPASVRILRERLSGGNLNVVELNDSYHVATLDNDADRIFSGSL
EFVHANASVPLQAD
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgccagtcatgcccggtgcggagccgtaccaccataaaggtggtcagatcggcgtcttg
ctctgccatggattcaccggctcgccccagtcgctgcgcccgtggggcgagcacctggcc
gcggcgggcctgaccgtggcgctgccccggctgcccggccacggcaccacctggcaggag
atgaaccgcacccggtgggaggactggtacgccgagctggacaggaccctggcggacctg
cgcggccggtgcaccgagatcttcgtgatgggcctgtccatgggcggctgcatggcgctg
cggctggcccaggtccacggcgcggggatcagggggctggtgatcgtcaacccgtcggtg
accagcgacgtgccgctgctccggctggcgccgctgctggggctggtggtcccgtcggtg
ccgggcgtggcgggtgacatcaagaaggagggggcgatcgagctaggctacacacgcact
ccggtcagggccgcggccagcctcacccggctgtgggcactgacccaggctgagctgggc
aaggtcacccagccggtgctggtcttccacagcccgcaggaccatgtggtgaaaccggcc
agtgtgcgtattctgcgtgagaggctgagcggggggaatcttaatgtggtggagctcaac
gacagctaccacgtcgcgacgctcgacaacgacgcggatcggatcttctcggggagcctg
gagttcgtccatgcgaacgcctcggtacccttgcaggcagactga

DBGET integrated database retrieval system