KEGG   Streptosporangium roseum: Sros_2755Help
Entry
Sros_2755         CDS       T01137                                 

Definition
(GenBank) Diphosphate--fructose-6-phosphate1-phosphotransf erase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
sro  Streptosporangium roseum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sros_2755
   00030 Pentose phosphate pathway
    Sros_2755
   00051 Fructose and mannose metabolism
    Sros_2755
   00052 Galactose metabolism
    Sros_2755
  Energy metabolism
   00680 Methane metabolism
    Sros_2755
Enzymes [BR:sro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Sros_2755
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Sros_2755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2992021..2993046
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRKGVSVYGHEFVGFRDGWRGPLEGDTMPLDIQAVRGI
LPRGGTILGSSRTNPIKIDGGVEKIKDNLAETGVDALIAIGGEDTLGVAKQLFDKGVKVV
GVPKTIDNDLSATDYTFGFDTAVNIATEAIDRLHTTAESHHRALICEVMGRHAGWIALHA
GMAGGANVILIPEKPFDIDRVCAYVESRFKTRYAPIVVVAEGAHPIEGQMALQAGELDSF
GHVRLGGIGEVLAKEIEKRTGKEARTTVLGHIQRGGTPTAFDRVLATRFGLHAIDAVHDG
HFGVMVALQGTDIVRVALAEATKELKTVPVSRYEEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattggagtgctaaccgggggcggcgactgccccggcctgaacgccgttatccgc
gctgtcgtgcgcaagggggtcagcgtctacgggcatgaattcgtcggattccgtgatggc
tggcgtggcccgctggaaggcgacaccatgccgttggacatccaggccgtgcggggcatt
ctgccgcgtggcggcacgattctcggctcgtcgcggaccaacccgataaagatcgacggc
ggcgtcgagaagatcaaggacaatctggcggagaccggggtcgacgcgctgatcgcgatc
ggcggcgaagacaccctcggcgtcgccaagcagctcttcgacaagggcgtgaaggtcgtc
ggcgtgccgaagacgatcgacaacgacctcagcgccaccgactacaccttcggcttcgac
accgccgtcaacatcgccaccgaggcgatcgaccggctccacaccaccgccgagtcccac
caccgcgcgctgatctgcgaggtcatgggccgtcacgcgggctggatcgccctgcacgcc
ggcatggccggcggcgccaacgtcatcctcatcccggagaagcccttcgacatcgaccgg
gtctgcgcctacgtcgagtcccgtttcaagacccgctacgcgccgatcgtcgtggtcgcc
gagggcgcccaccccatcgagggccagatggcgctgcaggcgggcgagctcgactccttc
gggcacgtccggctgggcggcatcggcgaggtgctcgccaaggagatcgagaagcggacc
ggcaaggaggcgcgcaccaccgtgctcggccacatccagcgtggcggcacgcccacggcc
ttcgaccgggtgctggccacccggttcggcctgcacgccatcgacgccgtgcatgacggc
cacttcggcgtcatggtcgcgctgcagggcaccgacatcgtcagggtcgctctcgccgag
gccaccaaggagctgaagaccgtgccggtcagccgctacgaggaggccgaggtcttcttc
ggctga

DBGET integrated database retrieval system