KEGG   Streptosporangium roseum: Sros_2805Help
Entry
Sros_2805         CDS       T01137                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sro  Streptosporangium roseum
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Sros_2805
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sros_2805
Enzymes [BR:sro01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Sros_2805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3044613..3045545
Genome map
AA seq 310 aa AA seqDB search
MKRHLISAADLSRDDALLILDTADELAKISERSIKKLPTLRGRTVVNLFFEDSTRTRISF
EAAAKRLSADVINFSAKGSSVSKGESLKDTALTLEAMGADAVVIRHGASGAPHRLAGWVR
GSVVNAGDGTHEHPTQALLDAFTMRRRLGPLDGRKVTIVGDVLHSRVARSNVLLLNTLGA
EVTLVAPPTLLPVTVDSWPCEVSYDLDSVLPKSDVVMMLRVQRERMNAAFFPTEREYSRR
YGLDRDRVAKMHDEAIVMHPGPMNRGMEIAAEVADSPRSTIVEQVANGVTTRMAVLYLLL
GGADLGGEIQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcggcacctgatctcggcggccgacctgagccgtgacgacgccctgctgatcctg
gacaccgccgacgagctggcgaagatctcggaacgctccatcaagaagctgcccaccctg
cgcggccgtaccgtggtcaacctcttcttcgaggactccacccggaccaggatctccttc
gaggcggcggccaagcgcctgtcggcggacgtcatcaacttctccgccaagggctccagc
gtctccaagggcgagtcgctcaaggacaccgcgctcaccctggaggcgatgggcgccgac
gccgtcgtcatccggcacggcgcctccggcgcgccgcaccgcctggccggctgggtgcgc
ggcagcgtcgtcaacgccggcgacggcacccacgagcaccccacccaggccctgctcgac
gccttcaccatgcgccgccgcctcggcccgctggacggcaggaaggtcaccatcgtcggc
gacgtgctgcacagccgggtggcccgctccaacgtgctgctgctgaacacgctcggcgcc
gaggtgaccctggtcgccccgcccacgctgctgccggtgaccgtggactcctggccgtgc
gaggtctcctacgacctcgactccgtgctgcccaagtcggacgtggtgatgatgctgcgc
gtgcagcgcgagcggatgaacgccgcgttcttccccaccgagcgggagtacagccgccgc
tacggtctcgaccgcgaccgcgtcgcgaagatgcacgacgaggccatcgtgatgcatccc
ggtccgatgaaccggggaatggagatcgcggccgaggtggccgactctccgcgctcgacg
atcgtcgagcaggtcgccaacggtgtgaccactcgcatggccgttctgtacctgctgctt
ggcggcgccgacctcgggggagagatccagtga

DBGET integrated database retrieval system