KEGG   Streptosporangium roseum: Sros_2813Help
Entry
Sros_2813         CDS       T01137                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
sro  Streptosporangium roseum
Pathway
sro00230  Purine metabolism
sro01100  Metabolic pathways
Module
sro_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sros_2813
Enzymes [BR:sro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Sros_2813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 AAA_33 AAA_22 RsgA_GTPase AAA_30 AAA_29 AAA_25 AAA_5 Rad17 AAA_28 ABC_tran CbiA MMR_HSR1 ParA RNA_helicase AAA_23
Motif
Other DBs
NCBI-ProteinID: ACZ85771
UniProt: D2B6K7
Position
3054680..3055384
Genome map
AA seq 234 aa AA seqDB search
MTGTSWPGESRVPEETAESGSGDFTSPVAGLVAARASAGPTGNRLTVLSGPSGVGKSTVV
AELRRAHPQVWLSVSVTTRKPRPGETHGVEYFFADDDEFDRLAASGELLEWAEFAGNRYG
TPRGPVLEKLAAGVPTLLEIDLQGARQVRASMPEAVLVFLAPPTWEELEKRLRGRGTEPE
DVIARRLAAGRIEMAAEQEFDLTLVNTSVQDVCHRLIALLADAPEASSPGRSPS
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggaacgtcgtggcccggcgagagtcgggtcccggaggaaaccgctgagagcggg
tccggtgacttcacctccccggtcgcaggcctggtggcggcgcgagcctccgccgggccg
accggcaaccgcctgacggtcctctcaggaccgtcaggcgtcggcaagtccacggtcgtc
gccgagcttcggcgggcacacccccaggtgtggctgtcggtctcggtgaccaccaggaag
ccccggccgggggagacccacggggtggagtacttcttcgccgacgacgacgagttcgac
cgcctggccgcctccggcgagctgctggagtgggccgagttcgccggcaacaggtacggc
acgccgcgcggcccggtgctggagaagctcgccgccggagtgcccacgctgctggagatc
gacctccagggcgcgcgccaggtccgggcgagcatgcccgaggcggtgctggtcttcctg
gccccgcccacctgggaggagctggagaagcgcctgcgcggcaggggaaccgaacccgag
gacgtcatcgcccggcgcctggcggcgggccggatcgagatggccgcggagcaggaattc
gacctgactcttgtgaacacgtccgtccaggatgtatgtcatcggctgatagccttactg
gctgatgctcccgaggcttcgagccccggtcgttcacctagctag

DBGET integrated database retrieval system