KEGG   Streptosporangium roseum: Sros_2903Help
Entry
Sros_2903         CDS       T01137                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sro  Streptosporangium roseum
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sro00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sro00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3163695..3165011)
Genome map
AA seq 438 aa AA seqDB search
MNEEVWLIEPSGPLRGDVEVRGSKNGVSKHMVAAMLGTGESTIHNAPDVGEVGITAQMLR
ALGIDVEITPREIRIAQGPQINPHVPAAFTGLNRIPILMLGPLLHLAGEAFVPLVGGDPI
GRRPVDFHVEALRAMGAEVEVSDTGVYAKAKRLRGTRLELPYPSVGATETILMSAVLAEG
KTVLKGAAMEPEVVELALFLQRMGARIELSPDRRIVIEGVERLRGASTWLNGDRIEAFSY
LAAGLITGGEVRVHGCPQDRLVTAITTLARMGAEMDITDDYVSASAPDGLRAAAVQTDTH
PGFMTDWQTPLMVLFTQAQGMSVLHETVFENRLVYVPALQRMGCEIEVFDVCLGGPACRY
HDTNAKHSAVVRGVSKLRGADVTLPDIRAGFSAVLAAAAAEGTSTLRGVHHIERGYHRPF
EQFASLGLKVSREEAPRE
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgaagaggtatggctgatcgagccctccgggccgctccgcggcgacgtcgaggtc
cgcgggtccaagaacggcgtctccaagcacatggtcgccgcgatgctgggcaccggtgag
agcacgatccacaacgcccccgacgtcggcgaggtcgggatcaccgcgcagatgctccgg
gcgctcggcatcgacgtggagatcacgccccgggagatccgcatcgcccaggggccgcag
atcaacccgcacgtgcccgccgcgttcaccggcctcaaccggatccccatcctgatgctg
ggcccgctgctgcacctggcgggcgaggcgttcgtgccgctggtgggcggcgacccgatc
ggacgccggcccgtcgacttccacgtcgaggcgctgcgcgccatgggggccgaggtcgag
gtgagcgacaccggcgtctacgccaaggccaagcggctgcgcgggacccggctcgaactg
ccctacccgagcgtgggcgccaccgagacgatcctgatgtcggcggtgctggccgagggc
aagaccgtgctcaagggcgcggccatggagcccgaggtggtggagctcgccctgttcctg
cagcgcatgggcgcgcgcatcgagctcagccccgaccggcgcatcgtgatcgagggcgtg
gagcggctgcgcggcgcctccacctggctcaacggcgaccggatcgaggcgttctcctac
ctggcggccggcctgatcaccggtggcgaggtgcgggtgcacggctgcccgcaggaccgg
ctggtcaccgcgatcaccaccctggcccggatgggcgccgagatggacatcaccgacgac
tacgtgtcggcctcggctccggacgggctgcgggcggcggcggtgcagaccgacacgcac
ccgggcttcatgaccgactggcagacgccgctgatggtgctgttcacgcaggcccagggc
atgtcggtgctgcacgagacggtgttcgagaaccggctggtctacgtgcccgccctgcag
cggatgggctgcgagatcgaggtcttcgacgtgtgcctcggcggcccggcgtgccgctac
cacgacaccaacgccaagcactcggcggtcgtgcggggcgtgtccaagctgcgcggcgcc
gacgtgacgctgcccgacatccgggccggcttctccgccgtgctcgccgcggcggccgcc
gagggcacctccacgttgcgcggggtgcaccacatcgagcggggctaccaccgccccttc
gagcagttcgcctcgctgggtctgaaggtcagccgggaagaggccccccgagagtaa

DBGET integrated database retrieval system