KEGG   Streptosporangium roseum: Sros_2907Help
Entry
Sros_2907         CDS       T01137                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
sro  Streptosporangium roseum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sro01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:sro00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3167732..3169039
Genome map
AA seq 435 aa AA seqDB search
MISRTDLRGALPEDLRHVLPRAELDVEAALEKVRPICEDVHHRGVEAVRELTARFDGVEL
ESTRVPAETVTRALEELDPRIRAALEESIRRARLVHRDQRRTDVTTQVVPGGTVTERWVP
VERVGLYVPGGRAVYPSSVVMNVVPAQEAGVSSLAVTSPAQKEFGGLPHPTILAACALLG
VDEVYAVGGAQAVAMFAYGTEECPPATMVTGPGNIWVAAAKRLLKGRIGIDSEAGPTEIA
ILADSTADPVHVAADLISQAEHDTIAAAVLVTDSAELAEAVERELPRQVAATKHGERVTE
ALSGRQSGIILVDDMEAGLRVVDAYAAEHLEIHTADAPALAARVRNAGAIFVGTYAPVSL
GDYLAGSNHVLPTGGCACHSSGLSVQTFLRGIHVVDYTREALAGAAAHVCVLADAEDLPA
HGAAIRARFDWEVPS
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcccgtaccgacctgcgcggagccctcccggaggacctccgccacgtgctgccc
cgtgccgaactcgacgtcgaagccgccctggagaaggtccggccgatctgcgaggacgtg
catcatcgcggcgtcgaggccgtgcgggagctgaccgcgaggttcgacggcgtcgagctg
gagtccacccgggtcccggccgagacggtcaccagggcgctggaggagctcgaccccagg
atccgggccgccctggaggagtcgatccgccgcgcccgcctggtccaccgcgaccagcgc
cgcaccgacgtcaccacccaggtcgtgcccggcggcaccgtcaccgagcgctgggtcccc
gtcgagcgcgtgggcctctacgtccccggcggccgggcggtctacccgtccagcgtggtc
atgaacgtcgtccccgcccaggaggcgggggtgtcctccctggcggtcacctcgcccgcg
cagaaggagttcggagggctgccgcacccgacgatcctggccgcgtgcgccctgctcggg
gtggacgaggtctacgccgtcggcggcgcccaggccgtggcgatgttcgcctacggcacc
gaggagtgcccgccggccaccatggtcaccggccccggcaacatctgggtcgccgccgcc
aagcggctgctcaagggccgcatcggcatcgactccgaggccggtcccaccgagatcgcg
atcctcgccgactccacggccgaccccgtgcacgtcgccgccgacctgatcagccaggcc
gagcacgacacgatcgccgccgctgtcctggtcaccgactccgccgagctggccgaggcc
gtcgagcgggagctgccccgccaggtcgccgccaccaagcacggcgagcgcgtcaccgag
gccctgtccggccgccagtcgggcatcatcctcgtcgacgacatggaggccgggctgcgc
gtcgtcgacgcctacgccgccgagcacctggagatccacaccgccgacgcgcccgcgctg
gcggcccgggtccgcaacgccggggccatcttcgtcggcacctacgcgccggtctcgctc
ggcgactacctcgccgggtccaaccacgtgctgcccaccggcggctgcgcctgccactcc
tccggactgtcggtgcagaccttcctgcgcggcatccacgtcgtcgactacacccgggag
gccctcgccggcgccgccgcccacgtgtgcgtcctggccgacgccgaggacctcccggcg
cacggcgcggcgatccgcgcgaggttcgactgggaggtcccctcgtga

DBGET integrated database retrieval system