KEGG   Streptosporangium roseum: Sros_2940Help
Entry
Sros_2940         CDS       T01137                                 

Definition
(GenBank) Tryptophan synthase (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sro  Streptosporangium roseum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sros_2940
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sros_2940
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sros_2940
Enzymes [BR:sro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sros_2940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3197241..3198485
Genome map
AA seq 414 aa AA seqDB search
MTATDGTLLTPADLAGNGVHGDDPDVHGKFGVFGGRYVPEALIPALDEVAAEYEKARNDA
GFLREFDHLLRTYAGRPTTLTEVPRFAEQAGGARIILKREDLTHTGAHKINNVLGQALLT
KRLGKTRVIAETGAGQHGVATATAAALMGLECVIYMGAVDCERQALNVARMKLLGATVVP
VTNGSQTLKDAINEAFRDWVANVDRTHYLFGTIAGPHPFPEIVRDFARIIGVEARRQMLE
LTGRLPDAVAAAVGGGSNAIGIFHAFIGDEGVQLHGYEAGGRGLETGEHALTLTEGSIGV
LHGSRTYVLQDEEGQTIDSHSISAGLDYPGVGPEHAWLKDTGRASYHGITDAEAMDAFAL
LARTEGIIPAIESSHALAGALKLGREMGPEATILVNLSGRGDKDMGTAMKYFNL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcgacagacggaacccttctcaccccggcggacctggccggcaacggcgttcac
ggggacgacccggacgtccacggcaagttcggcgtcttcggcgggcgctacgtgcccgag
gccctcatcccggcgctggacgaggtggccgccgagtacgagaaggccaggaacgacgcc
ggcttcctgcgcgagttcgaccacctgctgcgcacctacgccgggcggccgaccaccctc
accgaggtgccgcggttcgccgagcaggcgggcggcgcccggatcatcctcaagcgcgag
gacctgacccacaccggcgctcacaagatcaacaacgtgctcggccaggccctgctcacc
aagcgcctgggcaagacgagggtgatcgccgagaccggcgcgggccagcacggcgtggcc
accgccaccgccgccgccctgatgggcctggagtgcgtgatctacatgggggccgtcgac
tgcgagcgccaggcgctcaacgtcgcccgcatgaagctgctcggcgccaccgtcgtcccg
gtcaccaacggcagccagaccctcaaggacgccatcaacgaggccttccgcgactgggtc
gccaacgtcgaccgcacccactaccttttcggcacgatcgccggcccgcacccgttcccg
gagatcgtccgcgacttcgcccgcatcatcggcgtcgaggcccgccggcagatgctggag
ctcaccggcaggctgccggacgccgtcgccgccgcggtcggcggcggttccaacgcgatc
ggcatcttccacgccttcatcggcgacgagggcgtccagctccacggctacgaagccggc
ggccggggcctggagaccggcgagcacgccctcacgctcaccgagggctccatcggggtc
ctgcacggctcgcgcacctacgtcctgcaggacgaggaggggcagacgatcgattcccac
tcgatctccgccggcctcgactaccccggcgtcggccccgagcacgcctggctgaaggac
accggccgcgcctcctaccacggcatcaccgacgccgaggccatggacgccttcgcgctg
ctcgcccgcaccgagggcatcatcccggcgatcgagtcatcccacgcgctcgccggcgcc
ctcaagctcggccgtgagatgggacccgaggcgaccatcctggtcaacctctcgggccgt
ggcgacaaggacatgggcaccgccatgaagtacttcaacctctga

DBGET integrated database retrieval system