KEGG   Streptosporangium roseum: Sros_2941Help
Entry
Sros_2941         CDS       T01137                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sro  Streptosporangium roseum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sros_2941
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sros_2941
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sros_2941
Enzymes [BR:sro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sros_2941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3198553..3199347
Genome map
AA seq 264 aa AA seqDB search
MTTLQTVFARAKADDRAALIGYLPAGFPTKDGAIAAAAAMVDAGCDVIEIGLPYSDPLMD
GPTIQDAVHRSLTNGTRIADVLRTVEGVAKTGAATLVMTYWNPIDRYGADRFARALADAG
GVGTITPDLTPEEAEPWRAASAGAGIDTVFLVAPSSPESRIKAVVGCCTGFVYAASLMGV
TGARESVGEAAQGLVERTRLQTDMPVCVGLGVGTGKQAAEVARYADGVIVGSAFIRRLLD
APDEASGLAAVRELGAELAAGVRR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgacgactcttcagacggtgttcgccagggcgaaggcggacgatcgcgccgccctcatc
ggatacctccccgccggcttcccgacgaaggacggcgcgatcgcggccgccgccgccatg
gtggacgcgggctgcgatgtgatcgagatcggcctgccctactccgatccgctcatggac
ggcccgacgatccaggacgccgtgcaccggtcgctgaccaacggcacccgcatcgccgac
gtgctgcgcacggtcgagggcgtggccaagacgggcgccgccacgctggtcatgacctac
tggaacccgatcgaccgctacggcgccgaccggttcgcccgtgccctggcggacgcgggc
ggggtgggcaccatcacccccgacctgaccccggaggaggccgagccctggcgcgcggcc
agcgccggcgccgggatcgacaccgtcttcctggtcgcgccgagctctcccgagagccgt
atcaaggccgttgtcggctgctgcaccggcttcgtctacgccgcctcgctgatgggcgtc
acgggcgcccgcgagtcggtcggcgaggcggcccaggggctggtcgagcggacccgcctg
cagaccgacatgccggtctgcgtcgggctgggcgtcggcaccggcaagcaggccgccgag
gtggcccgctacgccgacggcgtcatcgtgggctcggcgttcatccgccgcctgctggac
gcccccgacgaggcctccggcctggcggcggtccgcgaactgggcgccgagctggcggcg
ggcgtccggaggtag

DBGET integrated database retrieval system