KEGG   Streptosporangium roseum: Sros_3226Help
Entry
Sros_3226         CDS       T01137                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sro  Streptosporangium roseum
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sros_3226
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Sros_3226
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sros_3226
Enzymes [BR:sro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Sros_3226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3513620..3515170
Genome map
AA seq 516 aa AA seqDB search
MEQKPSRRVFLSVAAAGAGGLLLTGAGRAPAVTPRALSRDPFTLGIASGDPSRDGFVLWT
RLALDPLGPDGRGGMPARDVDVEWQLATDERFAEVVRTGTETARWERAHSVHVEPAGLEP
GREYFYRFRAGGHLSPVGRTRTAPAALSPLTFAIAACAHYEHGYYTAYRRLAEQDPDLVV
HLGDYMYEYAPRGYTALGGSVRRHTAGKCATLADYRVRHAQYKSDADLQAAHAVAPWLVA
FDDHEIENNWAAGVSSSGAAGFARRRANAFQAYYENMPLRRASLPGGSSMRIHRRVDWGP
LARFHLLDTRQFRDDQACEDGLRSGCDERLATGRTLLGEGQRRWLLDGLAASGARWNLVG
QQILMAQRDSKVGPGTEVNMDSWDGYAAERARLLTGFRDSGAANPIVLTGDAHMHHAADL
RLDFDDPDSPRVAVELVTSSVASDGDGYRDRGRIAETLAENPHISYLDQRRGYIVCRLTS
DELRADFRTLDYISRRGAPAKTGARFTVPAGQSSLI
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
gtggagcagaagccgtcacgcagagtgttcctgtccgtcgccgccgcgggtgcgggcggc
ctgttgctcaccggggccggccgggccccggccgtgacccccagagccctgagccgcgat
ccgttcactctcgggatcgcctccggcgatccgtcgcgggacgggttcgtgctgtggacc
aggctcgccctcgacccgctgggcccggacgggcggggcgggatgccggcccgggacgtg
gacgtcgaatggcagctcgccaccgacgagcggttcgcggaggtggtccgcaccggtacc
gagaccgcgcgctgggagcgggcgcacagcgtccacgtcgagccggcggggctggagccc
ggacgggagtacttctaccgcttccgcgccggcggccacctgtcgccggtcggccgcacc
cgcaccgccccggccgccctgtccccgctcaccttcgcgatagccgcctgcgcccactac
gagcacggctactacaccgcgtacaggaggctggccgagcaggaccccgacctggtcgtg
cacctgggcgactacatgtacgagtacgcgccccgggggtacaccgcgctcggcgggagc
gtccgccggcacaccgcgggcaagtgcgccacgctggccgactaccgggtgcggcacgcg
cagtacaagagcgacgccgacctgcaggccgcgcacgcggtcgcgccctggctggtcgcc
ttcgacgaccacgagatcgagaacaactgggccgccggcgtctccagcagcggagccgcc
ggattcgcccggcgcagggccaacgccttccaggcctactacgagaacatgccgctgcgc
cgtgcgagcctgcccggaggctcgtcgatgcggatccaccgccgggtggactgggggccg
ctggcccggttccacctgctcgacacccggcagttccgcgacgaccaggcgtgcgaggac
gggctcaggtccggctgcgacgaacggctcgcgaccgggcgcaccctgctgggggagggc
cagcggcgctggctgctggacgggctggccgcctccggcgcccggtggaacctggtcggc
cagcagatcctgatggcccagcgcgactccaaggtcgggccgggcaccgaggtcaacatg
gactcctgggacggctacgccgccgagcgcgcccggctgctcaccggcttccgggactcc
ggcgcggccaacccgatcgtgctgaccggcgacgcgcacatgcaccacgcggccgacctc
aggctcgacttcgacgaccccgactcgccccgggtggcggtggagctcgtcacctcgtcg
gtcgccagcgacggcgacggctaccgggacagggggcggatcgccgagaccctcgcggag
aacccccacatctcctacctcgaccagcgccgcggctacatcgtctgccgcctcacctcc
gatgagctgcgggccgacttccgcacgctggactacatcagccgccggggcgcccccgcg
aagaccggcgcccgcttcaccgttccggcggggcaatcctccttgatctaa

DBGET integrated database retrieval system