KEGG   Streptosporangium roseum: Sros_3531Help
Entry
Sros_3531         CDS       T01137                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sro  Streptosporangium roseum
Pathway
sro00250  Alanine, aspartate and glutamate metabolism
sro01100  Metabolic pathways
sro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sros_3531
Enzymes [BR:sro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Sros_3531
Peptidases [BR:sro01002]
 Cysteine Peptidases
  Family C44
   Sros_3531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: ACZ86467
UniProt: D2AQS0
Position
complement(3913273..3915063)
Genome map
AA seq 596 aa AA seqDB search
MCGLSGEIRFDGRAADVGAVGRMTDAMHDRGPDGSGLWSLGPVALGHRRLKIIDLSDRAA
QPMVDSALGLTGVFNGCLYNYRELREELRGEGYRFFSTSDTEVLVKAFHRWGPECVEHFT
GMFAFAVFERDTGRLTLGRDRLGIKPMYVSQDASRLRFASSLPALLAGGGVGTDIDRVAL
HHYMTFHSVVPAERTILTGVRKLPSATVRTVEAGGTVTDHCYWRPPHTRSALPEYAGLTS
GEWNEAVLDRLRVAVRRRMVADVPVGVLLSGGLDSSMIVALLAEEGQEGLSTFSIGFHAA
GGESGDEFAYSDLVAGHFGTDHHRILVDDTRLLPALERAVGAMSEPMVSHDCVAFHLLSE
EVSRHVKVVQSGQGADEVFAGYSWYPPLAGLPREEAAATYAREFFDRPHGALAEVLAPDY
LADEDVSGEFVRRHLATPGADTALDAVLRLDTSVMLVDDPVKRVDNMTMAYGLEARTPFL
DHELVELAAACPPELKLASGGKGVLKDASRKLLPAEVIDRPKGYFPVPAIRHIHGPFLEL
VRDALTGQAARSRGLFNRPYVDRLLAAPDEHRTTLGANALWQLGLLELWLQAQGVR
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggactgagtggtgagatccggttcgacgggcgcgcggccgacgtcggcgccgtg
ggccggatgaccgacgcgatgcacgaccggggccccgacggatcgggcctgtggtcgctg
gggccggtcgccctgggccaccggcgcctgaagatcatcgatctgtccgaccgggccgcc
cagccgatggtggacagcgccctcggactgacgggggtgttcaacggctgcctgtacaac
taccgggagctgcgcgaggaacttcggggcgaggggtaccgcttcttctccacctccgac
accgaggtgctggtgaaggccttccaccgctgggggccggagtgcgtcgagcacttcacg
ggcatgttcgccttcgcggtcttcgagcgggacaccggccggttgacgctcggccgggac
cggctgggcatcaagccgatgtatgtctcccaggacgcctcgcggctccgtttcgcctcg
tcactgcccgcgctgctcgcgggaggaggggtgggcaccgacatcgaccgggtggccctg
caccactacatgaccttccactcggtggtgccggccgagcggacgatcctcaccggcgtg
cggaagctcccctcggcgaccgtacgcaccgtcgaggccggcggaacggtcaccgaccac
tgctactggcggccgccccacacccggtcggccctgcccgagtacgccgggctgacctcc
ggcgagtggaacgaggccgtgctcgaccggctgcgcgtggccgtacgcaggcgcatggtc
gcggacgtgccggtgggcgtgctgctctccggcggcctggactccagcatgatcgtcgcg
ttgctggccgaggagggacaggaggggctgtcgaccttcagcatcggcttccacgccgcg
ggcggcgagtcgggggacgagttcgcctactccgacctggtcgccgggcatttcggcacc
gaccaccaccgcatcctcgtcgacgacacgcgcctgctgcccgccctggagcgggcggtg
ggggcgatgagcgagccgatggtgagccatgactgcgtcgccttccacctgctgtcggag
gaggtctcccggcacgtcaaggtcgtgcagtccggccagggcgccgacgaggtgttcgcc
ggctacagctggtacccgccgctggccggcctgccgcgcgaggaggccgccgccacgtac
gccagggagttcttcgaccggccgcacggggcgctggccgaggtcctggcgccggactat
ctggcggacgaggacgtcagcggcgagttcgtccggcgccacctcgcgacgcccggcgcc
gacaccgcgctcgacgcggtgctgcgcctggacacctccgtcatgctcgtcgacgatccg
gtcaagcgcgtggacaacatgacgatggcctacgggctggaggcccggacgccgttcctc
gaccacgagctggtcgagctggcggccgcctgccctcccgagctcaagctcgcctcgggc
ggcaagggcgtgctgaaggacgcctcccgcaagctgctgcccgccgaggtcatcgaccgg
cccaagggatacttcccggtccccgccatccggcacatccacgggcccttcctggagctc
gtccgcgacgcgctgaccggacaggccgcgcggtcccgcggcctgttcaaccggccttac
gtggacaggctcctcgcggcgcccgacgagcaccggacgaccctgggggccaacgcgttg
tggcagctcgggctgctggagctgtggctgcaagcccagggagtccgatga

DBGET integrated database retrieval system