KEGG   Streptosporangium roseum: Sros_3740Help
Entry
Sros_3740         CDS       T01137                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
sro  Streptosporangium roseum
Pathway
sro00625  Chloroalkane and chloroalkene degradation
sro00680  Methane metabolism
sro01100  Metabolic pathways
sro01120  Microbial metabolism in diverse environments
sro01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Sros_3740
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sros_3740
Enzymes [BR:sro01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Sros_3740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: ACZ86663
UniProt: D2ASD6
Position
4152515..4153741
Genome map
AA seq 408 aa AA seqDB search
MTDNKGVTYQGPGKVEVQTIDYPEFELKDGPGVNPANVGRKVRHGAIVKTVATNICGSDQ
HMVRGRTTAPPGLILGHEITGEVVETGPDVEFIKNGDLVSVPFNIACGRCRNCKEGKTGV
CENVNPDRPGSAYGYVDMGGWPGGQANYVLVPYADWNLLKFPDKDRAMEKILDLAMLSDI
FPTGFHGCVTAGVKPGSTVYIAGAGPVGLAAGVSAFLLGAAVVIIGDLNKDRLAQARSFG
CETVDVSQGEPKDQIEQILGEPEVDCGVDAVGFEARGHGSEAGTEHPATVLNSLMEITRA
GGALGIPGLYVTGDPGAADEAAKQGSLSIRLGLGWAKSLAFTTGQCPVMRYNRQLMMAIL
NDRVQIAKAVNATPISLDQAPRGYEDFDKGAARKYVLDPNGMLGTAAS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgacggataacaagggcgtcacctaccaggggccgggcaaggtggaggtgcagaccatc
gactaccccgagttcgagctcaaggacggcccgggggtcaacccggccaacgtgggacgc
aaggtccggcacggtgcgatcgtcaagaccgtcgcgacgaacatctgcggcagcgaccag
cacatggtccggggccgcaccaccgcgccgccggggctcatcctcggccacgagatcacc
ggggaggtcgtcgagaccggccccgacgtggagttcatcaagaacggcgatctcgtgtcc
gtccccttcaacatcgcctgcggccgctgccgcaactgcaaggagggcaagaccggggtc
tgcgagaacgtcaaccccgaccggcccggttcggcctacggctacgtcgacatgggaggc
tggcccggcgggcaggccaactacgtgctcgtcccctacgccgactggaacctgctgaag
ttcccggacaaggaccgggcgatggagaagatcctcgacctggcgatgctctcggacatc
ttcccgaccggcttccacggctgcgtcaccgccggggtgaagccgggatcgaccgtctac
atcgcgggcgccggccccgtagggctcgccgccggcgtctcggcgttcctgctcggcgcc
gccgtggtcatcatcggcgacctgaacaaggaccgtctcgcccaggcccgcagcttcggc
tgcgagaccgtcgacgtgtcccagggggagccgaaggaccagatcgagcagatcctcggc
gagcccgaggtggactgcggcgtcgacgccgtcggattcgaggcccgcggccacggctcc
gaggcgggcaccgaacaccccgccaccgtgctcaactcgctcatggagatcacccgcgcg
ggcggcgcgctcggcatccccgggctgtacgtcaccggcgacccgggagccgcggacgag
gcggccaagcagggatcgctgtccatccggctcggcctcggctgggccaagtcgctcgcc
ttcaccaccggccagtgccccgtcatgaggtacaaccgccagctgatgatggcgatcctg
aacgaccgggtgcagatcgccaaggcggtcaacgccaccccgatctcgctcgaccaggca
ccccggggctacgaggacttcgacaagggcgccgcgcgcaagtacgtgctggacccgaac
ggcatgctgggcacggccgcctcgtag

DBGET integrated database retrieval system