KEGG   Streptosporangium roseum: Sros_3740Help
Entry
Sros_3740         CDS       T01137                                 

Definition
hypothetical protein
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
sro  Streptosporangium roseum
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sro01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:sro00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:sro00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4152515..4153741
Genome map
AA seq 408 aa AA seqDB search
MTDNKGVTYQGPGKVEVQTIDYPEFELKDGPGVNPANVGRKVRHGAIVKTVATNICGSDQ
HMVRGRTTAPPGLILGHEITGEVVETGPDVEFIKNGDLVSVPFNIACGRCRNCKEGKTGV
CENVNPDRPGSAYGYVDMGGWPGGQANYVLVPYADWNLLKFPDKDRAMEKILDLAMLSDI
FPTGFHGCVTAGVKPGSTVYIAGAGPVGLAAGVSAFLLGAAVVIIGDLNKDRLAQARSFG
CETVDVSQGEPKDQIEQILGEPEVDCGVDAVGFEARGHGSEAGTEHPATVLNSLMEITRA
GGALGIPGLYVTGDPGAADEAAKQGSLSIRLGLGWAKSLAFTTGQCPVMRYNRQLMMAIL
NDRVQIAKAVNATPISLDQAPRGYEDFDKGAARKYVLDPNGMLGTAAS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgacggataacaagggcgtcacctaccaggggccgggcaaggtggaggtgcagaccatc
gactaccccgagttcgagctcaaggacggcccgggggtcaacccggccaacgtgggacgc
aaggtccggcacggtgcgatcgtcaagaccgtcgcgacgaacatctgcggcagcgaccag
cacatggtccggggccgcaccaccgcgccgccggggctcatcctcggccacgagatcacc
ggggaggtcgtcgagaccggccccgacgtggagttcatcaagaacggcgatctcgtgtcc
gtccccttcaacatcgcctgcggccgctgccgcaactgcaaggagggcaagaccggggtc
tgcgagaacgtcaaccccgaccggcccggttcggcctacggctacgtcgacatgggaggc
tggcccggcgggcaggccaactacgtgctcgtcccctacgccgactggaacctgctgaag
ttcccggacaaggaccgggcgatggagaagatcctcgacctggcgatgctctcggacatc
ttcccgaccggcttccacggctgcgtcaccgccggggtgaagccgggatcgaccgtctac
atcgcgggcgccggccccgtagggctcgccgccggcgtctcggcgttcctgctcggcgcc
gccgtggtcatcatcggcgacctgaacaaggaccgtctcgcccaggcccgcagcttcggc
tgcgagaccgtcgacgtgtcccagggggagccgaaggaccagatcgagcagatcctcggc
gagcccgaggtggactgcggcgtcgacgccgtcggattcgaggcccgcggccacggctcc
gaggcgggcaccgaacaccccgccaccgtgctcaactcgctcatggagatcacccgcgcg
ggcggcgcgctcggcatccccgggctgtacgtcaccggcgacccgggagccgcggacgag
gcggccaagcagggatcgctgtccatccggctcggcctcggctgggccaagtcgctcgcc
ttcaccaccggccagtgccccgtcatgaggtacaaccgccagctgatgatggcgatcctg
aacgaccgggtgcagatcgccaaggcggtcaacgccaccccgatctcgctcgaccaggca
ccccggggctacgaggacttcgacaagggcgccgcgcgcaagtacgtgctggacccgaac
ggcatgctgggcacggccgcctcgtag

DBGET integrated database retrieval system