KEGG   Streptosporangium roseum: Sros_3907Help
Entry
Sros_3907         CDS       T01137                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sro  Streptosporangium roseum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sros_3907
Enzymes [BR:sro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Sros_3907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4353535..4354506
Genome map
AA seq 323 aa AA seqDB search
MNRYGRAAAALAFALVATACGEGPPSTTDGSGATRFYVDPEGTAVGELRRLEGEGKTEDA
ALIRRIAEQPNAIWIGDQDPHARVSDITAKAQEAGQVPVLVAYHIPDRDCGQFSAGGAAS
ADEYRSWIGRFAEAVGDRPAWVVVEPDALAHILDSCTQGGRAAERLGLLREAVRTLKKQP
NTKVYLDAGNAGWIQNADEWAEPMRQAGATEADGFAFNVSNFFTTEESVAAARRLSDGLG
GAHYVIDTSRNGNGPLREGADTWCNPRGRALGAEPTTRTGHDRVDAFLWIKRPGESDGDC
HRGEPRPGEWFSSYALELARNAG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggtacggccgcgcggccgccgcgctggccttcgccctcgtggcgacggcctgc
ggcgaaggtcccccctcgaccacggacggctccggcgcgacgcgcttctacgtcgacccc
gaaggcaccgccgtcggcgagctccgcaggctggagggggaggggaagaccgaggacgcg
gcgctgatccgcaggatcgccgaacagccgaacgcgatctggatcggtgaccaggacccg
cacgccagggtctccgacatcaccgccaaggcgcaggaggccggccaggtgccggtcctg
gtggcctaccacatccccgaccgcgactgcggccagttctcggcgggcggcgccgcgagc
gccgacgagtaccgctcgtggatcggccgcttcgccgaggccgtcggcgaccgccccgcc
tgggtcgtcgtcgaacccgacgcgctggcccacatcctcgacagctgcacccagggcggc
agggcggccgaacgcctcggcctgctccgggaggcggtgcggacgctgaagaagcagccc
aacaccaaggtctacctggacgccgggaacgccggctggatccagaacgccgacgaatgg
gccgagccgatgcggcaggccggggcgaccgaggcggacggcttcgccttcaacgtcagc
aacttcttcaccaccgaggagagcgtcgccgccgcccggcgcctgtcggacgggctcggc
ggggcgcactacgtgatcgacacctcgcgcaacggcaacggcccgctgcgcgagggcgcc
gacacctggtgcaaccccaggggccgggccctgggcgcggagccgacgacccggaccggg
cacgaccgggtggacgccttcctgtggatcaaacggcccggggagtccgacggcgactgc
caccggggagagccccggccgggtgagtggttctcctcctacgccctggaactcgcgcga
aacgcgggataa

DBGET integrated database retrieval system