KEGG   Streptosporangium roseum: Sros_4246Help
Entry
Sros_4246         CDS       T01137                                 

Definition
(GenBank) Cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
sro  Streptosporangium roseum
Pathway
sro00984  Steroid degradation
sro01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Sros_4246
Enzymes [BR:sro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Sros_4246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C Pyr_redox_2 NAD_binding_8 FAD_binding_2 GMC_oxred_N FAD_binding_3 GIDA DAO Pyr_redox UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ACZ87148
UniProt: D2AYD8
Position
complement(4729638..4731281)
Genome map
AA seq 547 aa AA seqDB search
MSDNTSGSTDSKGISRRGFIAGTGSILGVAALTGRATAAQAAALPAAAPISSGAHVPALV
IGTGYGGSVAALRLAQAGVDVHMIEMGMAWDTPGSDGKIFCNTREPDYRSYWLRTKSKAP
LNYFLGFPIDRNIPRYTGILDAEDFSGITVYQGRGVGGGSLVNGGMAVTPKRENFGAVLP
SVNAAEMYDIYYPRANAGLGVSSIDPAWFDSTACYQYARVGRKHAQRSGFPFVFVPDVYD
WDYMKQEAAGTVTKSALAGEILYGNNHGKKSLQQTYIARAKATGRVAISPLHKVTSVAPA
AGGGYTVVIDQINTNGDTTATKTVTADRVFFAAGSVGTSKLLVKLKATGALPNLNDEIGK
GWGDNGNVMCGRANHMWDPTGSLQSAIPCAGIDNWAAGGAFAEVAPLPTGIETYASFYLS
ITKNPNRAQFSWNAATGKVDLNWQTSWKQPSIDMAKTIFDKINSKEGTIYRTDLFGTYKI
WGDHLTYHPLGGAVLNKATDNYGRLAGHPGLYVIDGSLIPGNTSVNPFVTITALAERNIE
KIIATDL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaacacctcgggcagcaccgactccaaagggatctcacgtcgtggattcatc
gctggaaccggttccatcttgggggtcgcggcccttacgggtcgcgccaccgcagcccag
gcggcggccctccccgcggccgctccgatcagcagtggggcacacgtcccggccctggtg
atcggcaccggatacggcggctccgtcgccgccctgcgtctcgcccaggcgggcgtcgac
gtgcacatgatcgagatgggcatggcctgggacactcccggctccgacggcaagatcttc
tgcaacacgcgcgagccggactaccggtcctactggctgcgcaccaagagcaaggcgccc
ctcaactacttcctcggcttcccgatcgacaggaacatcccccgctacaccgggatcctg
gacgccgaggacttcagcggcatcacggtctaccagggccgcggcgtcggcggcggctcg
ctggtcaacggcggcatggcggtcacccccaagcgcgagaacttcggcgccgtcctcccg
tcggtgaacgccgccgagatgtacgacatctactatccgcgcgccaacgccgggctcggg
gtcagctccatcgatccggcctggttcgattccaccgcctgctaccagtacgcccgggtc
ggccgcaagcacgcccagcgttccggcttcccgttcgtcttcgtgcccgacgtctacgac
tgggactacatgaagcaggaggcggccgggaccgtcaccaagtcggcgctggccggagag
atcctctacggcaacaaccacggcaagaaatcgctgcagcagacctacatcgcccgggcc
aaggccaccggcagggtcgccatctcgccgctgcacaaggtcacctcggtcgctccggcg
gccggcggcggctacacggtcgtcatcgaccagatcaacaccaacggcgacaccacggcc
accaagaccgtgaccgcggacagggtgttcttcgccgccggcagcgtcggcaccagcaaa
ctgctggtcaagctgaaggccaccggcgcactgcccaacctcaacgacgaaatcggcaag
ggctggggcgacaacggcaacgtcatgtgcggccgcgccaaccacatgtgggacccgacc
ggcagtctccagtcggccatcccctgcgccggcatcgacaactgggccgccggcggcgcg
ttcgccgaggtcgcgccactgcccaccgggatcgagacctacgcctcgttctacctgtcg
atcaccaagaacccgaaccgcgcccagttctcctggaacgccgcgaccggcaaggtcgac
ctgaactggcagacctcctggaagcagccgtccatcgacatggccaagacgatcttcgac
aagatcaactcgaaggaggggacgatctaccggaccgacctcttcggcacctacaagatc
tggggcgatcacctcacctaccacccgctcggcggcgcggtcctgaacaaggccaccgac
aactacggccgtctcgccggccatcccggcctgtatgtcatcgacggctcgctgatcccc
ggcaacaccagcgtcaacccgttcgtcaccatcacggcgctcgccgaacggaacatcgaa
aagatcatagccaccgatctgtga

DBGET integrated database retrieval system