KEGG   Streptosporangium roseum: Sros_4246Help
Entry
Sros_4246         CDS       T01137                                 

Definition
cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
sro  Streptosporangium roseum
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Sros_4246
Enzymes [BR:sro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Sros_4246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4729638..4731281)
Genome map
AA seq 547 aa AA seqDB search
MSDNTSGSTDSKGISRRGFIAGTGSILGVAALTGRATAAQAAALPAAAPISSGAHVPALV
IGTGYGGSVAALRLAQAGVDVHMIEMGMAWDTPGSDGKIFCNTREPDYRSYWLRTKSKAP
LNYFLGFPIDRNIPRYTGILDAEDFSGITVYQGRGVGGGSLVNGGMAVTPKRENFGAVLP
SVNAAEMYDIYYPRANAGLGVSSIDPAWFDSTACYQYARVGRKHAQRSGFPFVFVPDVYD
WDYMKQEAAGTVTKSALAGEILYGNNHGKKSLQQTYIARAKATGRVAISPLHKVTSVAPA
AGGGYTVVIDQINTNGDTTATKTVTADRVFFAAGSVGTSKLLVKLKATGALPNLNDEIGK
GWGDNGNVMCGRANHMWDPTGSLQSAIPCAGIDNWAAGGAFAEVAPLPTGIETYASFYLS
ITKNPNRAQFSWNAATGKVDLNWQTSWKQPSIDMAKTIFDKINSKEGTIYRTDLFGTYKI
WGDHLTYHPLGGAVLNKATDNYGRLAGHPGLYVIDGSLIPGNTSVNPFVTITALAERNIE
KIIATDL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaacacctcgggcagcaccgactccaaagggatctcacgtcgtggattcatc
gctggaaccggttccatcttgggggtcgcggcccttacgggtcgcgccaccgcagcccag
gcggcggccctccccgcggccgctccgatcagcagtggggcacacgtcccggccctggtg
atcggcaccggatacggcggctccgtcgccgccctgcgtctcgcccaggcgggcgtcgac
gtgcacatgatcgagatgggcatggcctgggacactcccggctccgacggcaagatcttc
tgcaacacgcgcgagccggactaccggtcctactggctgcgcaccaagagcaaggcgccc
ctcaactacttcctcggcttcccgatcgacaggaacatcccccgctacaccgggatcctg
gacgccgaggacttcagcggcatcacggtctaccagggccgcggcgtcggcggcggctcg
ctggtcaacggcggcatggcggtcacccccaagcgcgagaacttcggcgccgtcctcccg
tcggtgaacgccgccgagatgtacgacatctactatccgcgcgccaacgccgggctcggg
gtcagctccatcgatccggcctggttcgattccaccgcctgctaccagtacgcccgggtc
ggccgcaagcacgcccagcgttccggcttcccgttcgtcttcgtgcccgacgtctacgac
tgggactacatgaagcaggaggcggccgggaccgtcaccaagtcggcgctggccggagag
atcctctacggcaacaaccacggcaagaaatcgctgcagcagacctacatcgcccgggcc
aaggccaccggcagggtcgccatctcgccgctgcacaaggtcacctcggtcgctccggcg
gccggcggcggctacacggtcgtcatcgaccagatcaacaccaacggcgacaccacggcc
accaagaccgtgaccgcggacagggtgttcttcgccgccggcagcgtcggcaccagcaaa
ctgctggtcaagctgaaggccaccggcgcactgcccaacctcaacgacgaaatcggcaag
ggctggggcgacaacggcaacgtcatgtgcggccgcgccaaccacatgtgggacccgacc
ggcagtctccagtcggccatcccctgcgccggcatcgacaactgggccgccggcggcgcg
ttcgccgaggtcgcgccactgcccaccgggatcgagacctacgcctcgttctacctgtcg
atcaccaagaacccgaaccgcgcccagttctcctggaacgccgcgaccggcaaggtcgac
ctgaactggcagacctcctggaagcagccgtccatcgacatggccaagacgatcttcgac
aagatcaactcgaaggaggggacgatctaccggaccgacctcttcggcacctacaagatc
tggggcgatcacctcacctaccacccgctcggcggcgcggtcctgaacaaggccaccgac
aactacggccgtctcgccggccatcccggcctgtatgtcatcgacggctcgctgatcccc
ggcaacaccagcgtcaacccgttcgtcaccatcacggcgctcgccgaacggaacatcgaa
aagatcatagccaccgatctgtga

DBGET integrated database retrieval system