KEGG   Streptosporangium roseum: Sros_4356Help
Entry
Sros_4356         CDS       T01137                                 

Definition
protein-L-isoaspartatecarboxylmethyltransferase-like protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sro  Streptosporangium roseum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4862738..4863970)
Genome map
AA seq 410 aa AA seqDB search
MTTGPLSSATPDLLRAVMVATLKEWGSIRSPQVEAAFAAVPRERFAPEAPLEAVYSVPDV
VVTKRGPDGRATSSISAPWLQAEMLETAQLTPGAKVLEVGSGGYNAALIAEIVGPSGSVT
TIDIDPFVTERAERFLAETGYSHVRVVLGDAEHAAAEHVPEGGFDAIIVTVGVWDIPWGS
LLAPAGRMVVPLRFSTISRSFTFVRDGDRFVGLDPTVCGFVAAQGAGTLPDQEAVLADGA
VRLTLEEGPILDVAVLDQALTGDRTELWTGVTVGRGEPFDSMHLWIATTDDRFGMIWQDP
DRDCGMVKVAMGWYCPVLITADSFAYLAIRELPRAQEATEHRWEFGVCGYGPAGAELARH
LHDHVQVWDLDWRTHAAPTFTLYPADALPPAPAVGRIFRKRHTQLVMTWQ
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccggccccctgtcttccgccacccctgacctgctgcgcgccgtcatggtcgcc
acgctcaaggaatggggctcgatccgctccccgcaggtcgaagcggccttcgccgcggta
ccgcgtgagaggttcgcgcccgaggcgccgctggaggccgtctactccgtcccggacgtg
gtcgtcaccaagcgcggcccggacggcagggcgacgagttcgatcagcgcgccctggctc
caggccgagatgctcgaaaccgcgcagctcacccccggcgcgaaagttctcgaggttggg
tccggcggctacaacgccgcgctcatcgctgagatcgttggcccctccggctcggtgacc
accatcgacatcgacccgttcgttaccgagcgggcggagcgcttcctggctgagaccggc
tactcgcacgtgcgggtcgtgctgggcgatgccgagcatgccgccgccgagcacgtgccc
gagggcggctttgacgccatcatcgtcactgtcggcgtctgggacatcccgtgggggtct
ctgctggccccagccggccggatggtggtgccgctgcggttctccacgatcagccggtcg
ttcaccttcgtccgggacggtgaccgcttcgtcggcctggaccccaccgtgtgcggattc
gttgcggcgcagggagccgggacgctcccggatcaagaggcggtcctggccgatggcgcg
gtgaggttgacactggaagagggccccatccttgacgtcgccgtgctcgaccaggccttg
accggcgaccgtaccgagctgtggaccggcgtcacggtcggccggggtgagccgttcgac
tcgatgcacctgtggatcgcgaccacagatgatcggttcggcatgatctggcaggaccca
gaccgcgactgcggcatggtcaaggtggcgatgggctggtactgccctgtgcttatcacc
gccgacagcttcgcctacctcgcgatccgcgaactgccccgggcgcaggaggcgacggag
caccggtgggagttcggtgtctgcggatacgggcccgctggcgccgaactcgcccgccac
ctccatgatcacgttcaggtgtgggacctcgactggcggacccacgccgctccgacgttc
accctctaccccgccgatgccctcccgcctgccccggcggtcggccggatcttccgcaag
cggcacacccaactggtcatgacctggcagtag

DBGET integrated database retrieval system