KEGG   Streptosporangium roseum: Sros_4357Help
Entry
Sros_4357         CDS       T01137                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sro  Streptosporangium roseum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Sros_4357
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sros_4357
  Lipid metabolism
   00071 Fatty acid degradation
    Sros_4357
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sros_4357
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sros_4357
   00626 Naphthalene degradation
    Sros_4357
Enzymes [BR:sro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sros_4357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4864172..4865308)
Genome map
AA seq 378 aa AA seqDB search
MRIRGAVLEEIGRARPYAESRPLSICELELDPPGPDELLIRVEAAGVCHSDLSVVDGNRV
RPVPMLLGHEAAGVVEQVGVGVDDIAVGQRVVMAFLPRCGACEGCATDGVMPCVRGSAAN
NEGTLLTGGIRLHRDGARVLHHLGVSAFATHAVVDRHSVVPVGDDVPPEVAAVLGCAVLT
GGGAVINVGEPAPGQTVMVVGLGGVGMAALITALALDGVTVIGVDGNPDKLDTARKLGAH
ATYSPAEIAELKIKAAVVIEAAGNARAFESAVAATAPGGRTVTVGLPAPHARSSISPLGL
VAEGRAIIGSYLGSAVPARDIPVFAQMWREGRLPVDALVSARIGLSAVNEAMDQLADGKA
VRQVIMFGENEAPVQGSR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgagaatccgcggagccgtcctcgaggagatcggccgggcacgcccgtacgccgagtcc
cgtccgctgtcgatctgcgagctcgaactggacccgcccggccccgacgagctcctcatc
agggtcgaggcagccggtgtgtgccactccgatctgtcggtcgtcgatgggaacagggtg
cggcccgtacccatgctcctgggacacgaggcggccggtgtggtggagcaggtcggcgtc
ggcgtcgatgacatcgcagtcggccaacgggtcgtcatggccttcctgccccgctgcggc
gcgtgcgagggctgcgccaccgacggtgtgatgccctgtgtccgtgggagcgcggccaac
aacgagggaacgttgctgaccggtggcatccgcctgcaccgcgatggcgccagggtcctg
caccacctcggggtctcggccttcgccacccacgcggtcgtggaccggcactcggtcgtc
ccggtgggcgacgatgtccctcctgaggtcgccgcagttctcggctgcgccgtgctcacc
ggcggcggcgcggtcatcaacgtcggcgaacccgcccccggccagacggtgatggtcgtc
gggctcggcggcgtcggcatggccgcgctgatcaccgcccttgccctggacggcgtcacg
gtcatcggcgtcgacggcaatccggacaagctcgacaccgcgcggaagctgggcgcccac
gcgacctacagccccgccgagatcgccgagctcaagatcaaggcggcggtcgtcatcgaa
gcggccgggaacgcccgcgctttcgagagcgcggtcgccgcgaccgcccccggtggccgc
accgtcaccgtggggcttccagcgcctcacgcccgatcatcgatctcgccgctcgggctc
gtggcggagggacgagccatcatcggaagctacctcggttcagcggttcccgcccgtgac
atccccgtcttcgcccagatgtggcgcgaaggaaggctgccggtcgacgcgctggtgtcg
gcaaggatcgggctctctgccgtgaacgaggcgatggaccagctcgccgatgggaaggcc
gtccggcaggtcatcatgttcggcgagaacgaggcccccgttcaggggtcccggtag

DBGET integrated database retrieval system