KEGG   Streptosporangium roseum: Sros_4362Help
Entry
Sros_4362         CDS       T01137                                 

Definition
carbohydrate kinase FGGY
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sro  Streptosporangium roseum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Sros_4362
Enzymes [BR:sro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Sros_4362
Exosome [BR:sro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sros_4362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4870593..4872173)
Genome map
AA seq 526 aa AA seqDB search
MTRERRRGVLSIDEGTTGTRAAAVLDDGGAAPPAYLPLSVRSPDHLRVEQDATEIWANTV
KVCREALDWAAAHRVEITGVSISTQRATVLLWDTVTGSPLSQAVVWQDRRYAARLREWEP
EWDARLAEHTGRPVGSRAPLLWAAEEIAGNAAVRRAHGEGRLAFGSVDTWLVWKLTGGAR
HVMSATNAVAAGAYDLRTGDWHEPWVEFLGCPRDVLPEIVDDDGDFGATDPSVLGVRLPI
LSVMGDQHAAMIALGAHRPGQATTVHGTGTFLDAVAGDRPPVHRRQVPGVLTLVGWRSQG
TPVFSLEGYASTTGSAMRRLCEEIKLFDSPAQLSELAREHTGPTRVMFLPALAGLRTPVW
SPEATGILTGLSLSTTRAELARGILNGFAHSVCDLLEGVEEVMGRPVTDLFCGGGLAGSD
VLMSGQADLIGRPVRRARDHETASLRGTAYLGGVRAGLWPSISAAVAGLQAAPLFEPTLS
EAERLEARAAWRDLLARHIITAGPGARPPGPGSPGPGPDAQEESTS
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgacaagggaacgccgccgaggcgtactgagcatcgatgagggcaccacgggcacccgg
gccgccgccgtcctcgacgacggcggcgccgccccacccgcgtacctgcccctctcggtc
cgctcgcccgaccatctacgggtcgagcaggacgcgacggagatctgggcgaacaccgtc
aaggtctgccgtgaggcgctggactgggcggccgcgcaccgggtggagatcaccggagtg
tcgatctccacccagcgcgccacggtgctgctgtgggacacggtgaccggctccccgctg
agccaggccgtggtgtggcaggaccgccggtacgccgcccggctgcgagagtgggagccg
gaatgggacgcgcgcctggccgagcacaccggccggccggtcggctcccgggcgccgctg
ctgtgggcggcggaggagatcgccggtaacgcggccgtccgccgggcccacggcgagggc
aggctggccttcggctcggtcgacacctggctggtctggaagctcaccgggggtgcacgc
cacgtcatgtcggccacgaacgccgtggccgcgggcgcctacgatctacggacgggcgac
tggcacgagccgtgggtcgagttcctcggctgcccgcgcgacgtgctgccggagatcgtc
gacgacgacggcgacttcggcgccaccgacccgtccgttctcggcgtgcggctgcccatc
ctgtccgtcatgggcgaccagcacgcggcgatgatcgcgctcggcgctcaccggccaggc
caggccacgaccgtccacgggaccggcacgttcctcgacgccgtcgcgggcgaccggccg
cccgttcaccgccgccaggtgccgggggtgctcactctcgtcggctggcggtcgcagggc
acacccgtgttcagcttggagggctacgcctcgacgaccgggtcggcaatgcggcggctg
tgcgaggagatcaagctgttcgactcgccggcccagctgtccgaactcgcccgcgagcac
accgggccgacccgggtgatgttcctgcccgcgctggcggggctgcggacaccggtctgg
tcaccggaggccacggggatcctcaccgggctcagcctgtccacgacccgggcggagctg
gcccgcggcatcctcaacggcttcgcgcactcggtgtgcgacctgctggaaggcgtggag
gaggtcatgggcaggccggtcaccgacctgttctgcggaggcgggctcgccggcagcgac
gtgttgatgtccggccaggcggatctgatcggccggccggtacggcgtgcccgcgaccac
gagaccgccagcctccgcggcaccgcctacctcggcggcgtacgggccgggctgtggccg
agcatctcggcggccgtcgccgggctccaagcggcccccctcttcgaacccaccctttcc
gaggccgagcgcctggaggcccgcgccgcgtggcgcgacctgctggctcgccacatcatc
acggccgggcccggcgcccggccaccgggaccgggctcccccggtcccggacccgatgca
caggaggaatcaacgtcgtga

DBGET integrated database retrieval system