KEGG   Streptosporangium roseum: Sros_4372Help
Entry
Sros_4372         CDS       T01137                                 

Definition
(GenBank) pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sro  Streptosporangium roseum
Pathway
sro00260  Glycine, serine and threonine metabolism
sro00750  Vitamin B6 metabolism
sro01100  Metabolic pathways
sro01110  Biosynthesis of secondary metabolites
sro01120  Microbial metabolism in diverse environments
sro01230  Biosynthesis of amino acids
Module
sro_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sros_4372
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sros_4372
Enzymes [BR:sro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sros_4372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACZ87255
UniProt: D2B021
Position
complement(4879098..4880276)
Genome map
AA seq 392 aa AA seqDB search
MNDTTSTVIDTPFLYDRSGRRYAVTDRRWRGEDGTPLALSPMPGLTPDQIDTSERSLWRY
HAAIPVSPRHRVSLGEGFTPMLPLDWNGLRVHFKLEWFNPTSSFKDRGITVMISHLRGQG
ETHVLEDSSGNGGSSVAAYAAAAGIHAKIIVPAATSAAKILQARAYGAQIELVEGTREQV
SDEAIRQSEQIPYASHNWHPFFLQGTKTIAYEMWESLGFRAPDNIVLVAGAGSNILGCDI
AFSELLEARQIDRRPKLLVGQPEHWATIADAVNGIDPRSRGPRVPTIAEGASIANPVRLP
ETVEAIRRSGGAAVAVTEDQIRTAVRKLASRGLYAEPTSSVAAAALDHFMADGAIGPDET
TVVILTGAGLKSAEKMAAVFDTDSNPDEESHA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacaccaccagcaccgtgatcgataccccgttcctctacgacaggtccggccgg
cgttacgcggtcaccgaccggcgctggcgcggtgaggacgggacgcctctcgcactcagc
ccgatgccagggctcacgcccgaccagatcgacaccagcgaacgctccctttggcgctac
catgccgcgatcccggtctcccctcgacaccgggtgagtctcggagagggcttcaccccc
atgctgccactggactggaacgggctgcgcgttcacttcaagctcgagtggttcaacccc
acctccagcttcaaggaccgcggcatcacggtgatgatctcccacctgcgcggacaggga
gagacgcacgtccttgaggacagctccggcaacggcggctcctcggtcgcggcctacgcg
gctgccgccgggattcacgccaagatcatcgtccccgcggcgacgtcggccgccaagatc
ctccaggcacgcgcgtacggcgcccagatcgaactcgtcgaaggcactcgggagcaggtg
tccgacgaggcgatccgtcagtctgagcagatcccctacgccagccacaattggcacccg
ttctttctgcagggcaccaagacgatcgcctacgagatgtgggagtcgctcgggttcagg
gcgcctgacaacatcgtgctcgtagcgggtgcgggcagcaacatcctcggctgtgacatc
gcgttcagcgagctgctcgaagcgcgtcagatcgacagacgccccaaacttctggtcggc
caaccggagcactgggccaccatcgcggacgcggtgaacgggatcgatccgcggagccgg
ggaccgcgggtcccgacgatcgcggaaggagcctccatcgccaacccggtccggctcccg
gagaccgtcgaggcgatccgtcgctcaggtggtgcggcagtggcggtcaccgaggaccag
atccgtacagccgtgcgcaagctggcctcgcgtggtctgtacgccgagccgaccagcagc
gtcgccgcagcggccctcgatcacttcatggccgacggcgccatcggccctgacgagacc
accgtcgttatcctcaccggcgccggactcaagtccgcagagaagatggccgctgtcttc
gacaccgacagcaatccagacgaggagagccacgcgtga

DBGET integrated database retrieval system