KEGG   Streptosporangium roseum: Sros_4487Help
Entry
Sros_4487         CDS       T01137                                 

Definition
exodeoxyribonuclease V (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sro  Streptosporangium roseum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sro00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sros_4487
Enzymes [BR:sro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Sros_4487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5003625..5005841)
Genome map
AA seq 738 aa AA seqDB search
MKPGSGGPSAASIDAVLERITYANEETGYTIARVATERSGSDLLTVVGPLLGAQPGESLR
LTGRWTSHPKYGKQFEVWSYATVLPATVQGIQRYLGSGLIKGIGPKMAERIVDHFGADTL
QIIETAPERLVEVPGLGPKRTKMIGIAWEEQKIIKEVMIFLQGVGVSTSIAVRIFKQYGD
ASITVVKSEPYRLADDVWGIGFKTADTIAQAVGIPHDSPERVKAGLRYTLSQAADDGHCY
LPAPNLVADAVKILEVPAELTVRCLEELVAEEGVVREEVPAGDSLVPAVYLVPFHRAELS
LAGSLRALLTSGHDRLGVFGSVDWQVALEWLHKQTDAELAPEQAHAVRLALCEKVAVLTG
GPGCGKSFTVRSIVTLARAKKAKVILAAPTGRAAKRLAELTGHEATTVHRLLQLRPGGDA
TFDRDNPLDADLVVVDEASMLDLLLANKLVKAIAPGTHLLFVGDVDQLPSVGAGEVLRDL
LAAEEEIPRVRLTHIFRQAQESGVVVNAHRVNTGLPPALEGMGDFFLFPCEEPEEIAALT
VDVVANRIPRKFGLNPRRDVQVLAPMHRGAAGAGNLNNALQEALTPSREGMPERRYGGRV
YRVGDKVTQLRNNYDKGAAGVFNGTVGVVVDIKPDDHKLTVLTDEDENVEYAFDELDELA
HAYAVSIHRSQGSEYPAVVIPLATSAWMMLQRNLLYTAITRAKKLVVIVGSRRALAQAVR
TRGAGRRHTSLTHRLRSP
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcctggatcgggtggtccctctgccgcgtccatcgacgccgtcctcgaacgcatc
acctacgccaacgaggagaccggctacaccatcgccagggtggccaccgaacgctcgggc
agcgatctgctgaccgtcgtcgggccgctgctgggcgcccagcccggcgagtcgctgcgg
ctgaccgggcgctggacctcccatcccaagtacggcaagcagttcgaggtatggtcctac
gccaccgtgctgcccgccaccgtccagggcatccagcgctacctcggctccgggctgatc
aagggcatcgggccgaagatggccgagcggatcgtcgaccacttcggcgccgacaccctg
cagatcatcgagaccgcccccgagcggctggtcgaggtccccggcctcggccccaagcgg
accaagatgatcggcatcgcctgggaggaacagaagatcatcaaagaggtgatgatcttc
cttcagggagtcggcgtctcgacctccatcgcggtgcggatcttcaagcagtacggcgac
gcctccatcacggtcgtcaagagcgagccctaccggctggccgacgacgtgtggggcatc
ggcttcaaaaccgccgacaccatcgcccaagccgtcggcatcccgcacgacagccccgaa
cgggtcaaggcgggcctgcgctacaccctgtcgcaggcggccgacgacggccactgctac
ctgccggcccccaacctcgtcgccgacgcggtgaagatcctggaggtcccggccgagctg
accgtccgctgcctggaagaactggtcgccgaggagggcgtggtccgcgaggaggtcccc
gccggcgacagcctcgtccccgcggtctacctggtccccttccaccgcgccgagctgtcg
ctggccggctccctgcgcgccctgctgacctccggccacgaccggctgggcgtcttcgga
tcggtggactggcaggtggcgctggaatggctgcacaagcagaccgacgccgagctcgcc
cccgagcaggcccacgccgtacggctggcgttgtgcgagaaggtcgcggtgctgaccggc
gggcccggctgcggcaagagcttcaccgtgcgctccatcgtcaccctcgcgcgcgccaag
aaggcgaaggtcatcttggccgcgcccaccggccgggcggccaagaggctcgcggagctg
accggccacgaggccaccaccgtgcaccggctgctgcaactgcgccccggcggggacgcc
accttcgaccgcgacaaccccctggacgccgacctggtcgtggtcgacgaggcctcgatg
ctggacctgctgctggccaacaaactggtcaaggccatcgcgccgggcacgcacctgttg
ttcgtgggggatgtggaccagctgccctcggtcggcgccggcgaggtgctgcgggacctg
ctggccgccgaggaggagatcccccgggtacggctgacccacatcttccgccaggcacag
gagtcgggcgtggtcgtcaacgcccaccgcgtcaacaccggcctgcccccggcactggag
ggcatgggcgacttcttcctgttcccgtgcgaggagccggaggagatcgcggcgctgacc
gtcgatgtggtggccaaccggatcccgcgcaagttcggcctcaacccgcgccgggacgtg
caggtgctggcgccgatgcaccggggcgccgcgggggcgggcaacctcaacaacgcgctg
caggaggcgctgaccccctcgcgcgagggcatgcccgaacgccgctacggcggccgtgtc
taccgggtcggcgacaaggtgacccagctgcgcaacaactacgacaagggcgcggcgggg
gtgttcaacgggaccgtgggcgtggtggtcgacatcaaacccgacgaccacaagctgacc
gtgctgaccgatgaggacgagaacgtcgaatacgccttcgacgagctggacgagctggca
cacgcctacgcggtgtccatccaccgctcccagggcagcgagtatccggcggtggtcatc
ccgctggccaccagcgcgtggatgatgctgcagcgcaacctgctctacaccgcgatcacc
cgggccaagaagctcgtcgtcatcgtcggctcacgccgggcgctggcccaggcggtgcgc
acccgcggcgccggacggcgtcacaccagcctcacccaccggctgcgctcgccttag

DBGET integrated database retrieval system