KEGG   Streptosporangium roseum: Sros_4953Help
Entry
Sros_4953         CDS       T01137                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sro  Streptosporangium roseum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sros_4953
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sros_4953
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sros_4953
Enzymes [BR:sro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sros_4953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5479996..5481216
Genome map
AA seq 406 aa AA seqDB search
MGEMSRSGRQGVPAPAAPARAMSDPGATGRFGTYGGRYVPESLIPACHEIEAAFREAWSD
PEFRGRLDTLLTVYAGRPTPLTPAWRLSHELGITLFLKREDLTHTGSHKINNVIGQALLA
HRMGKERLLAETGAGQHGVATATAAALLGLKATVFMGERDIERQELNVLRMNVLGAEVVP
VTTGSRTLKDACNEAMRHWVSSVDNSYYCIGSVMGPHPYPWMVREFQRVIGEEARAQCAA
ELPVGVPDYVVACVGGGSNAAGTFAGFVDTTARLIGVEAEGGAAATFGRAGVLHGFRSLV
LQDEDGQVTEAHSVAAGLDYPGIGPEHAHLRDGGRARYETVNDEEVVQALLCLARTEGIL
AALESSHAVAWVIRAAKSGEIAPGSTVMLTLSGRGDKDIASIKELL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagatgtcccggtccggtcggcagggcgtcccggcgcccgccgcccccgcccgc
gcgatgagcgaccccggtgccaccggccggttcggaacctacggcgggcggtacgtaccg
gagtcactgatccctgcctgccacgagatcgaggcggcgttccgtgaggcctggagcgac
cccgagttccgcggcaggctcgacaccctgctcacggtctacgccggccgccccactccg
ctgacccccgcctggcggctctcccatgagctcggcatcaccctgttcctcaaacgcgag
gatctcacgcacaccggctcacacaagatcaacaatgtgatcggccaggcgctgctcgct
caccggatgggcaaggaacggctgctggccgagaccggcgcgggccagcacggcgtcgcc
acggccaccgccgcggcgctcctgggtctcaaggcgaccgtgttcatgggcgagcgcgac
atcgaacggcaggagctcaacgttctgcggatgaacgtgctgggcgcggaggtcgtgccg
gtcacgaccgggagccgcaccctcaaggacgcctgcaacgaggcgatgcggcactgggtg
tcgtcggtggacaactcctactactgcatcgggtcggtgatgggtccgcatccctatccg
tggatggtgcgcgagttccagcgggtgatcggtgaggaggcccgcgcccagtgcgccgcc
gaactccccgtcggtgtgcccgactacgtggtcgcctgcgtcggtggcggctccaacgcc
gccggcacgttcgccggcttcgtcgacaccaccgcccggctcatcggggtcgaggccgag
ggcggcgcggcggcgaccttcggcagggccggggtgctgcacggcttccgctcgctggtc
ctccaggacgaggacggccaggtgacggaggcccattcggtcgcggccggcctcgactat
ccggggatcggccccgagcacgcccatctgcgcgacggggggcgcgcccgctacgagacc
gtgaacgacgaagaggtcgtccaggcgctgctgtgcctggcccgcaccgaggggatcctg
gccgcactggagtcctcgcacgccgtggcctgggtgatccgggccgccaagtccggcgag
atcgcgccggggtcgaccgtgatgctgactctctccggcaggggagacaaggacatcgcc
tccatcaaggagctgctgtga

DBGET integrated database retrieval system