KEGG   Streptosporangium roseum: Sros_4954Help
Entry
Sros_4954         CDS       T01137                                 

Definition
(RefSeq) tryptophan synthase (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sro  Streptosporangium roseum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sros_4954
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sros_4954
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sros_4954
Enzymes [BR:sro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sros_4954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5481213..5481998
Genome map
AA seq 261 aa AA seqDB search
MTDSLEEFLIARRGTGRPLLVPYVTAGVTPGWTDVVHAYADAGADAVELGFPFSDPMLDG
VTIQEASDRAIAAGTTVKGILEEVATLDVDVPLIAMTYSNLVVQQSTAEFCAALTAGGLR
GLIVPDSPLEEVGELADAAAAEGLHLVLLAAPSSSRARLREIAERSRGFVYALTRMGTTG
EHSEVPEQAARLGRELKGLTDRPVLFGFGVSNPAQAAELAGHADGVVVASALMRKLLDGA
RPRELGEYVASIRRALDQGAR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgattccctggaagaattcctgatcgcacgccgtggcacgggacgtcccctgctg
gtgccctatgtcaccgccggggtcacccccggatggacggacgtcgtccacgcctacgcc
gacgccggagccgacgccgtcgagctgggcttccccttctccgatcccatgctggacggc
gtcacgatccaggaggcctccgaccgggcgatcgcggccgggaccacggtcaaggggatc
ctcgaggaggtcgcgacgctcgacgtcgacgtgccgctcatcgcgatgacctacagcaat
ctggtggtgcagcagagcaccgcagagttctgtgcggcgctcaccgcgggcggactgcgc
gggctgatcgtgcccgactcgcccctggaggaggtcggggagctggcggacgccgcggcg
gccgagggcctgcatctcgtactgctcgccgctccctcctcctcccgggccagactgcgc
gagatcgccgagcgcagccggggcttcgtctacgccctgacccgcatgggcaccaccggc
gagcacagcgaggttcccgagcaggccgcccggctcggccgcgagctcaagggactcacc
gaccggccggtcctgttcggtttcggggtctccaacccggcgcaggccgccgagctggcg
ggtcatgccgacggcgtcgtggtggcttcggcgctgatgcgcaagctcctcgacggcgcc
cggccacgcgagctgggagaatatgtggcgagcattcgacgcgcactcgaccagggagcc
agatga

DBGET integrated database retrieval system