KEGG   Streptosporangium roseum: Sros_4996Help
Entry
Sros_4996         CDS       T01137                                 

Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sro  Streptosporangium roseum
Pathway
sro00010  Glycolysis / Gluconeogenesis
sro00052  Galactose metabolism
sro00500  Starch and sucrose metabolism
sro00520  Amino sugar and nucleotide sugar metabolism
sro00521  Streptomycin biosynthesis
sro01100  Metabolic pathways
sro01110  Biosynthesis of secondary metabolites
sro01120  Microbial metabolism in diverse environments
sro01130  Biosynthesis of antibiotics
sro01200  Carbon metabolism
Module
sro_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sros_4996
   00052 Galactose metabolism
    Sros_4996
   00500 Starch and sucrose metabolism
    Sros_4996
   00520 Amino sugar and nucleotide sugar metabolism
    Sros_4996
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sros_4996
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Sros_4996
Enzymes [BR:sro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sros_4996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ACZ87795
UniProt: D2B8I5
Position
complement(5516628..5517569)
Genome map
AA seq 313 aa AA seqDB search
MTHALAVDIGGTKIAAALVDPRGVVSHRWTHPTPRTDDPEEMFRTVERLAARVVATAGDI
ARNAPLGVGSAGPLDPRAGTVSPVNIPAWRAFALVDRLAESLGRPVVLAGDGHCFALGEH
FAGAGAGSRALLGVVVSTGVGGGLVLDGAPRFGPSGNSGHVGHMIVDPEGEPCVCGSRGC
VETYASGPGMVRWARGQGWRAGEPEADAVVLAADAREGQTVATAAFDRAARALAGALLST
AAVVDLDLVVVGGGVARSGDALFVPLRTWLERLAGLDFLRRVRLRPSALGGDAGLVGAAA
LTRRPVPAAGAVT
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgacccatgccttggccgtcgacatcggcggcaccaagatcgccgccgcgctcgtcgat
ccccgcggcgtcgtctcgcaccgctggacccatcccacgccgcgtaccgacgaccccgag
gagatgttccggacagtggagcggctcgccgcgcgcgtcgtggccaccgccggtgacatc
gcgcggaacgcaccgctcggcgtcggctcggccggtccgctggacccgcgcgccggcacc
gtgagcccggtcaacatccccgcctggcgcgcgttcgcgctcgtggaccggctcgccgag
tcactcggccggcccgtggtgctggccggggacgggcactgcttcgcgctcggcgagcac
ttcgccggcgccggcgccgggtcgcgcgcgctgctcggcgtggtcgtctccacgggcgtc
ggcggcggcctggtgctggacggcgcgccccggttcgggccctccgggaactccgggcac
gtcggccacatgatcgtcgatcccgagggcgagccgtgcgtgtgcggctcgcgcggctgt
gtcgagacgtacgcctccgggccgggcatggtgcgctgggcgcgcggccaggggtggcgg
gccggggagccggaggccgacgccgtcgtgctggccgccgacgcccgcgagggccagacg
gtcgccaccgccgcgttcgaccgcgccgcccgcgccctggccggggcgctgctgtccacc
gcggccgtcgtggacctcgacctcgtcgtggtcgggggtggcgtcgcccggtccggggac
gcgctgttcgtcccgctgcgcacctggttagagcgcctggccgggctggacttcctgcgg
cgcgtacggctccgcccgtccgcgctcggcggcgacgccgggctggtcggggccgccgcg
ctgacccggcggcccgtcccggcggcgggagcggtgacgtga

DBGET integrated database retrieval system