KEGG   Streptosporangium roseum: Sros_5683Help
Entry
Sros_5683         CDS       T01137                                 

Definition
beta-glucosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sro  Streptosporangium roseum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sros_5683
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Sros_5683
Enzymes [BR:sro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sros_5683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6215947..6217509
Genome map
AA seq 520 aa AA seqDB search
MPHHSPTLARLAMTVLQPGFDGTAPPDWLRRALSEGLGGAVLFARNLAGPAQTAELVAGL
RRENPAVVVAVDEEGGAVTRLEARTGSSWPGNRALGVADDAERTERVAREIGRLLASADI
TLDYAPVVDVNANPANPVIGIRSFGPDPELVSRQTTAWITGLQGAGVAACAKHFPGHGDT
VTDSHHALPTVHADLELLQERDLPPFRAAVKAGVQAVMCGHLLVPALDPGNPATLSRRIL
TGLLREEMGFGGMLVTDAIEMGAVAALHPPGEIAVRALAAGVDAICVGVSSPGGESVYAL
RDAIVRAVHDGRLPEERLAEAAGRVLALAGWYAENAAARARDTERTREAPDAEAPEAPEG
RGGRDPRGGGEELGLQAARAAMRVTVAGDRTAPPPVLSRPPLVVDIAPRLNLAIDPSTPT
GLVGAMTELLPGTTGHTVAAETADLPDLSDHRRPLVLVAHDAPRHAWVRDLLARAVGLRP
DAIVIETGLPGEPTGAVHIATHGISRVSARAAALWLTGGQ
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgccccaccacagccccaccctggcccggctggccatgaccgtgctccagcccggcttc
gacggcaccgcaccgcccgactggctgcgccgggcgctctccgaagggctcggcggcgcc
gtgctgttcgcccggaatctcgccggcccggcgcagacggccgagctcgtcgccggcctg
cgccgggagaacccggccgtggtggtcgcggtggacgaggaaggcggagcggtcacccgg
ctggaggccaggaccggcagctcctggccgggcaaccgggcgctcggcgtggccgacgac
gccgagcgcaccgagcgggtcgcccgcgagatcggccgcctcctcgcctcggccgacatc
accctcgactacgcccccgtggtggacgtcaacgccaacccggccaacccggtgatcggc
atccgttccttcggccccgaccccgagctggtgtcccggcagaccaccgcctggatcacg
gggttgcagggcgccggggtggccgcctgcgccaagcacttccccggtcacggcgacacc
gtcaccgactcccaccacgcgctgccgaccgtccacgccgacctcgagctcctccaggag
cgcgacctgcctccgttccgcgcggccgtcaaggccggggtccaggccgtgatgtgcggc
cacctgctggtgcccgcacttgatcccggcaaccccgccacgctgagcaggcggatcctg
accggcctgctccgcgaggagatgggcttcggcggcatgctggtcaccgacgcgatcgag
atgggagccgtcgccgccctgcaccccccgggcgagatagcggtccgcgcgctggccgcg
ggggtggacgcgatctgcgtcggcgtgtcctcgcccggcggggagagcgtctacgcgctg
cgggacgcgatcgtgcgggccgtacacgacggcaggctgcccgaggagcggctggccgag
gcggcgggacgcgtgctggccctggccggctggtacgccgagaacgccgccgcgcgggca
cgggacacggagcggacgcgggaggcgccggacgcggaggccccggaggccccggagggg
cggggaggacgggatccgcgagggggaggcgaggagctcggcctgcaggccgcccgcgcg
gccatgcgcgtgaccgtcgcgggcgatcggaccgcgcctccgcccgtcctctcccgcccc
ccgctggtcgtcgacatcgccccgcgcctgaacctggcgatcgacccctccacccccacc
ggcctcgtcggcgccatgaccgagctgctgccgggcaccaccgggcacaccgtcgccgcc
gagaccgccgacctccccgacctctccgaccaccggcgcccgcttgtcctggtggcgcac
gacgccccccgccacgcgtgggtccgggacctgctggcccgcgccgtcgggctgcgcccc
gacgcgatcgtgatcgagaccgggctgcccggcgaacccaccggggcggtgcacatcgcc
acacacggtatttcccgggtttcggcccgcgccgccgccctgtggctgaccggcggccaa
tag

DBGET integrated database retrieval system