KEGG   Streptosporangium roseum: Sros_5885Help
Entry
Sros_5885         CDS       T01137                                 

Definition
chelatase protein
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
sro  Streptosporangium roseum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sros_5885
Enzymes [BR:sro01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Sros_5885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6450038..6452179)
Genome map
AA seq 713 aa AA seqDB search
MTTSKEISKVRDPRYPFTAIVGSEDLKLALILNAVSPRVGGVLVRGEKGTAKSTIVRALA
ALLPAVEVVNGCRFSCDPAAPDPECPDGPHEVRTGAARPARLVELPVGASEDRLAGSLDI
ERALTEGVKAFEPGLLAAAHRGVLYVDEVNLLHDHLVDLLLDAAALGTCYVEREGVSVRH
AARFLLVGTMNPEEGELRPQLLDRFGLTVEVRASREPSQRAEVVRRRLAFDAGPEGFAAR
WSEQERALAARIAEARARVADVVLPDAALRQIATVCAAFEVDGLRADLVTANAAIAHAAW
QGRTAVTADDVREAARLALPHRRRRDPFDAPGLDESKLEDLLGQVPDEPDDDPDGPGPGG
DGSGGDGTSEDGTSEDGSGGEDPGGDGSAEDGPGGNGPGGEGPRPAPPGAPDAGPGSAGA
PSPDAPSPEAGTAAGPRPEAGTTRRDQAFDADPARPARLFTVPGIGAGAPGRRSRARTPL
GRTTGARTPEGRPASLHLKATVGAAAPYQLGRGRSGPGLLLRREDLREAVREGREGNLVL
FVVDASGSMAARQRMRAVKTAVLGLLLDAYQRRDKVGLVTFRGTRADLVLPPTSSVEAGA
ARLRDLPTGGRTPLAAGLLRAAEVLRVERLRDPARRPLVVLVTDGRATSGTVEDSHRAAG
LLAGVTGVVVDCESGHVRLGLARSLADRMGAETVRLDELADLAGMIRERRAAA
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgacgacatccaaggagatctcgaaggtgcgtgacccgcgctatcccttcaccgcgatc
gtgggatcggaggacctgaaactcgcgctcatcctcaacgccgtctccccccgcgtcggc
ggggtgctggtccggggcgagaagggcaccgccaagtccacgatcgtgcgggcgctggcg
gcgctgctgcccgccgtcgaggtggtgaacggctgccgcttctcgtgcgaccccgccgcg
ccggaccctgagtgtccggacgggccgcacgaggtccggaccggggccgcccggcccgcg
cgcctggtcgagctgcccgtcggcgcctccgaggaccgcctggccggctcgctcgacatc
gaacgcgccctcaccgagggggtgaaggccttcgagcccggcctcctcgcggccgcgcac
cggggcgtcctgtacgtcgacgaggtcaacctgctccacgaccacctggtcgacctgctg
ctcgacgccgccgcgctcggcacctgctacgtcgagcgcgagggggtgtcggtacggcac
gccgcccggttcctgctggtgggcaccatgaaccccgaggagggggagctgcggccgcag
ctcctcgaccggttcgggctgaccgtggaggtccgggcgtcgcgggagccgtcccagcgg
gcggaggtggtacggcgccgcctggcgttcgacgccggaccggaggggttcgccgcccgc
tggtccgagcaggagcgggcgctggcggcacgcatcgccgaggcgcgggcccgggtggcg
gacgtggtcctgccggacgccgcgctgcggcagatcgccacggtctgcgcggcgttcgag
gtggacggcctccgcgccgacctggtcaccgcgaacgccgcgatcgcccacgccgcctgg
cagggccgtaccgccgtcaccgccgacgacgtgcgcgaggcggccaggctcgccctcccg
caccgccgccgccgggacccgttcgacgcccccggcctggacgagtccaagctggaggac
ctcctcggccaggtccccgacgagcccgacgacgacccggacggccccggccccggcggt
gacggctccggcggggacggcacctccgaggacggcacctccgaggacggctccggcggc
gaggatccaggcggtgacggctccgcggaggacggtcccggcgggaacggccccggcggg
gaggggccccgtcccgcgccccccggcgctccggacgcgggccccggcagcgccggcgct
ccgtcgcccgacgccccgtcacccgaggccgggacggccgcgggcccgaggccggaggcc
ggcaccacccgccgcgaccaggccttcgacgcggatccggcgcgaccggccaggctgttc
accgtccccgggatcggcgccggcgcccccgggaggaggtcgagggccaggacccccctg
ggccggaccaccggcgcccggacccccgagggccgtcccgcctccctgcatctgaaggcg
accgtcggcgccgccgcgccgtaccagctcggccgcggcaggagcggccccggcctgctg
ctgcggcgcgaggacctcagggaggccgtccgcgagggccgcgagggcaacctggtgctg
ttcgtcgtggacgcgagcggatccatggcggcccggcagcgcatgcgcgccgtcaagacg
gccgtgctgggcctgctgctcgacgcctaccagcgccgtgacaaggtcgggctggtcacc
ttccgcggcacccgcgccgacctcgtcctgccgcccacctcctccgtcgaggcgggcgcg
gcccggctgcgcgacctgcccaccggcggccgcaccccgctcgccgcgggactgctccgg
gccgccgaggtgctgcgggtggagcgcctgcgcgaccccgccaggcgtccgctggtggtc
ctcgtcaccgatgggcgggccacctccggcaccgtcgaggactcccaccgcgccgcgggg
ctgctggccggagtgacgggcgtggtggtggactgtgagagcgggcacgtccgcctcggc
ctggcccggtccctggcggaccggatgggcgccgagaccgtgcgcctcgacgagctcgcc
gacctcgccgggatgatccgcgagcggcgggccgccgcatga

DBGET integrated database retrieval system