KEGG   Streptosporangium roseum: Sros_5922Help
Entry
Sros_5922         CDS       T01137                                 

Definition
(GenBank) Uroporphyrinogen-III synthase-like protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sro  Streptosporangium roseum
Pathway
sro00860  Porphyrin and chlorophyll metabolism
sro01100  Metabolic pathways
sro01110  Biosynthesis of secondary metabolites
sro01120  Microbial metabolism in diverse environments
Module
sro_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sros_5922
Enzymes [BR:sro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Sros_5922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: ACZ88657
UniProt: D2AU02
Position
complement(6492687..6493856)
Genome map
AA seq 389 aa AA seqDB search
MSIALLDDPGGSPETAPDALAGFTIGVTATRRREEFCALLERRGARVVRAPAIRLVPLAE
DADLLAATRAALTGPLDDVVVTTGVGFRGWMAAAEGWGLSGDLSAHLTAARLLTRGPKAR
GAVRAAGLNDHWTPATESCEEVKQYLLAQDLRGRRIAVQLHGEPLTGFVAALREAGAEVI
EVPVYRWLPYRDTSPLRRLISQSISGGVDAVAFTSAPAVLAMLAAARADGLEDALVAAFA
GPVVAACVGPVTAAPLQARGVPAVQPERARLGALARTLARHLPEHSVTRLLAGGHGLEIR
GHAVAVDGELKPLPPAPMAVLKRLADKPGHVVARSELRTVLPGGPSRDSAEHAVEMAITR
LRRALGPSGIVETVVKRGYRLACDRGEAM
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgcccttctggacgaccccggcgggtctcccgagacggcgcccgacgcgctg
gccgggttcacgatcggggtgaccgcgaccaggcggcgtgaggagttctgcgcgctgctg
gagcggcggggcgcgagagtggtgcgcgccccggcgatcaggctggtgccgctggccgag
gacgccgacctgctggccgcgacccgggccgctctgacgggcccgctcgacgacgtggtg
gtcaccaccggggtcgggttccggggctggatggccgcggccgagggctgggggctgtcg
ggcgacctgtcggcgcacctgaccgccgcccggctgctgacccgcgggcccaaggcccgc
ggcgcggtccgggccgccgggctgaacgaccactggacgccggccaccgagtcgtgcgag
gaggtcaagcagtacctccttgcccaggacctgcgcggtcgccgcatcgccgtgcagttg
cacggggagccgctgaccggcttcgtggccgcgctgcgcgaggcgggggccgaggtcatc
gaggtgccggtctaccggtggctgccctaccgcgacacctcgccgctgcgccgcctgatc
agtcagtcgatctccggcggggtggacgcggtggccttcaccagcgcccccgccgtgctg
gccatgctcgccgcggcccgcgccgacggcctggaggacgccctggtggcggccttcgcc
gggccggtcgtcgccgcctgcgtgggcccggtcacggcggcgccgctgcaggcgcgcggg
gtgcccgccgtacagcccgagcgtgcccgcctcggcgcgctggcccggacgctcgcccgg
cacctgcccgagcacagcgtcacccgcctgctcgccggcggccacgggctggagatccgc
ggccacgccgtcgccgtggacggtgagctcaagccgctgccgccggccccgatggcggtg
ctcaagcgcctggccgacaagccggggcacgtggtggcccgctccgagctgcgcaccgtg
ctgcccggcggcccctcccgggactcggccgaacacgccgtcgagatggccatcacccgc
ctgcgccgcgccctgggcccctccggcatcgtcgagacggtcgtcaagcgcggctaccgc
ctggcctgcgaccgcggcgaggccatgtga

DBGET integrated database retrieval system