KEGG   Streptosporangium roseum: Sros_6036Help
Entry
Sros_6036         CDS       T01137                                 

Definition
(RefSeq) triose-phosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sro  Streptosporangium roseum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sros_6036
   01230 Biosynthesis of amino acids
    Sros_6036
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sros_6036
   00051 Fructose and mannose metabolism
    Sros_6036
   00562 Inositol phosphate metabolism
    Sros_6036
Enzymes [BR:sro01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sros_6036
Exosome [BR:sro04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sros_6036
  Exosomal proteins of bladder cancer cells
   Sros_6036
  Exosomal proteins of melanoma cells
   Sros_6036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6614571..6615356)
Genome map
AA seq 261 aa AA seqDB search
MTTARKPLMAGNWKMNLNHLEAIAHTQKLAFALNDKDFDRVEVAVLPPFTDLRSVQTLVD
GDKLRIVYGGQDLSQHDGGAYTGDVSGAMLAKLGCTFVLAGHSERRQYHHEDDDLVNAKV
QAAYRHSLTPILCVGEGLPVRQAGDQVAHSVSQLDGALRKVTAEQARSVVLAYEPVWAIG
TGEVATPADAQEVCSALRVRLAELYDGEVAAAVRILYGGSVKSDNIAGIMAQPDVDGALV
GGASLDPGEFVKICRFGEMSV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacggcgcgcaaaccgctcatggccggcaactggaagatgaacctcaaccacctt
gaggccatcgcccacacccagaagctggcgttcgcactgaacgacaaggacttcgacagg
gtcgaggtggcggttctgccaccgttcaccgatctgcgcagcgtgcagaccctggtggac
ggcgacaagctgcggatcgtgtacggcgggcaggacctgtcgcagcacgacggcggcgcc
tacaccggcgacgtctccggggcgatgctcgccaagctcggttgcaccttcgtcctggcc
gggcactccgagcgccggcagtaccaccacgaggacgacgacctggtcaacgccaaggta
caggcggcctaccggcactcgctcacgccgatcctgtgcgtgggggagggcctgccggtc
cgccaggccggcgaccaggtggcccacagcgtctcgcagctcgacggggcgttgcgcaag
gtcaccgcggagcaggccaggtccgtcgtgctggcctatgagccggtctgggcgatcggc
accggcgaggtggccactccggccgacgcgcaggaggtctgctcggcactgcgtgtccga
ctcgccgagctgtatgacggcgaggtggccgccgctgtccgtatcctttacggtggctcg
gtcaaatctgacaacatcgccggcatcatggcccagcccgatgtggacggtgcgctggtg
ggtggcgccagtctggatccgggcgagttcgtgaagatctgccgcttcggcgaaatgtcc
gtctga

DBGET integrated database retrieval system