KEGG   Streptosporangium roseum: Sros_6081Help
Entry
Sros_6081         CDS       T01137                                 

Definition
phenylalanine--tRNA ligase (EC:6.1.1.20)
Orthology
K01890  
phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]
Organism
sro  Streptosporangium roseum
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:sro00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6671071..6673587)
Genome map
AA seq 838 aa AA seqDB search
MKAPLSWLREYVDLPAVTAHEIADRLTAAGLKLEAVTSYGYDVKNVVVGEVLAIEELQGF
KKPIRHCQVEVGEAAPREIVCGATNFAVGDRVPVVLPGGVLPGGFEVGARKTYGRMSEGM
ICSERELGLSDEHAGIMVLAEGTPIGADVVELLGLRDDVIEMEITPDIGYALSIRGVARE
AATAFDSAFLDPADVSPPAEAGPSYPASIADPTACDRFVLREVHGFDPSARSPLWMRTRL
TRAGVRPVSLAVDVTNYVMLETGQPLHAFDAGKLTGEIVVRRAEPGETLETLDHVVRELH
PEDILITDGSGAISMAGTMGGLHTEISDTSTDIVIEAAHFSASGIARESRRHNLVSEASK
RFERGVDRELPLYASWRAAQLLAELGGGTIQPGVTHAEVEVEPVRISIPSGHPGRVAGVG
YDRETVIRHLEQVGCTVVAGTVAPADELAAKLAVTGDDMLTVTPPSWRPDLTDPNDLAEE
VIRLEGYENLPSILPAAPAGAGLSESQRLRRRVGRALAASGYVEVLAYPFVGERDFDNLQ
LPAGDARRRAVRLANPLSEDEPLMRTTLLPGLLKTLVRNVGRGFGDVALFETGLVYRPSQ
DAPATAPVLGVDRRPTEEELASIEAALPAQPLRVGAVLAGEFERSGWWGKGRAGTWADAV
EAARTVAREAGVTLDVRADRHEPWHPGRCAALYAGDVLVGHAGELHPRVIEAYGLPARTS
AMELELTRLESPSAGPVAAPAISAYPIATQDVALIVDAATPVAAVEAALCEGAGDLLESV
RLFDVYTGAQAGEGRKSLAYSLRFRAPDRTLTAEEASAARDAAVALAGERTGAQLRGV
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccccgctttcatggctgcgggagtacgtcgatctccccgccgtcaccgcgcac
gagatcgccgacaggctcaccgccgccgggctcaagctggaggccgtcacctcctacggc
tacgacgtcaagaacgtggtcgtcggcgaggtgctggccatcgaggagctgcagggcttc
aagaagcccatccggcactgccaggtcgaggtgggggaggccgcgccgcgtgagatcgtc
tgcggcgccaccaacttcgcggtcggcgaccgggtgccggtcgtgctgcccgggggcgtg
ctgcccggcgggttcgaggtcggcgcccgcaagacctacggccggatgtccgagggcatg
atctgctcggagcgcgagctcggcctgagtgacgagcacgccggcatcatggtgctggcc
gagggcaccccgatcggggccgacgtggtcgagctgctcggcctgcgcgacgacgtgatc
gagatggagatcaccccggacatcggctacgcgctgtcgatccgcggcgtggcccgcgag
gcggccaccgccttcgactcggcgttcctcgacccggccgacgtctccccgcccgccgag
gcaggcccgtcctacccggcctccatcgccgacccgaccgcctgcgaccgtttcgtgctg
cgcgaggtccacggcttcgacccgtcggcgcggagcccgctgtggatgcggacccggctc
acgcgggccggcgtccgcccggtctcgctggccgtcgacgtcaccaactacgtgatgctg
gagacgggccagcccctgcacgccttcgacgccgggaagctgaccggtgagatcgtggtg
cgccgggccgagccgggcgagacgctggagacgctcgaccacgtcgtccgcgagctccac
ccggaagacatcctgatcaccgacggatcgggcgcgatctcgatggccgggaccatgggc
ggcctgcacaccgagatctccgacacctccaccgacatcgtgatcgaggccgcgcacttc
tccgccagcggcatcgcgcgcgagtcccgccgccacaacctggtcagcgaggcctccaag
cgcttcgagcggggcgtggaccgggagctgccgctgtacgcctcctggcgcgcggcccag
ctcctggccgagctcggcggcggcacgatccagccgggcgtgacccacgccgaggtcgag
gtcgagccggtccgcatctccatcccgagcggtcaccccggcagggtcgccggagtcggc
tacgaccgcgagaccgtgatccgccacctggagcaggtcggctgcacggtggtcgcgggt
acggtcgcccccgccgacgagctcgccgccaagctggcggtcaccggcgacgacatgctg
acggtcaccccgccctcgtggcggcccgacctgaccgacccgaacgacctcgccgaggag
gtcatccggctcgagggctacgagaacctgccctcgatcctgcccgccgcgccggcgggc
gccggtctcagcgagagccagcggctgcgccgccgggtgggccgggcgctggcggcctcc
ggctacgtcgaggtcctggcctacccgttcgtcggggagcgcgacttcgacaacctgcag
ctgcccgccggcgacgcgcgccgccgggccgtacggctggccaaccccctcagcgaggac
gagccgctgatgcggaccacgctgctgccggggctgctcaagacgctggtccgcaatgtc
ggccggggcttcggcgacgtggcgctgttcgagacgggcctggtctaccggccctcgcag
gacgcgcccgcgaccgcgccggtgctcggggtggaccgcaggccgaccgaggaggagctc
gcctccatcgaggccgcgctgcccgcccagccgctgcgggtgggcgccgtgctggccggg
gagttcgagcggtccggctggtggggcaaggggcgtgcgggcacctgggcggacgccgtc
gaggcggcccgcacggtggcccgggaggccggggtcaccctcgacgtccgcgccgaccgg
cacgagccctggcacccgggccgctgtgcggcgctgtacgccggggacgtgctcgtcggt
cacgcgggtgagctgcacccgcgcgtcatcgaggcgtacggcctgcccgcgcggaccagc
gcgatggagctggagctgacccggctggagtcgccgtcggccggtccggtggcggcgccc
gcgatctccgcttatccgatcgccacgcaggacgtcgcgctcatcgtcgacgccgccacc
ccggtggccgcggtggaggcggcgctgtgcgagggagcgggcgacctgctggagtcggtc
cggctgttcgatgtctacaccggggcccaggccggagagggccggaagtccctggcctac
tccctgcggttccgggcgccggaccggacgctgaccgccgaggaggccagcgcggcccgt
gacgcggccgtggcgctcgccggagagcgcaccggagcccagctccgcggcgtctga

DBGET integrated database retrieval system