KEGG   Streptosporangium roseum: Sros_6280Help
Entry
Sros_6280         CDS       T01137                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sro  Streptosporangium roseum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Sros_6280
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sros_6280
  Lipid metabolism
   00071 Fatty acid degradation
    Sros_6280
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sros_6280
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sros_6280
   00626 Naphthalene degradation
    Sros_6280
Enzymes [BR:sro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sros_6280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6890709..6891800
Genome map
AA seq 363 aa AA seqDB search
MRAVVFDAFGSDLRVCEVPAPAPPPGGAVIRVEATGLCRSDWHGWQGHDPDIRVLPHVPG
HELAGVVEDVGPGVGSWRAGDRVTVPFVCACGSCTACAAGDQQVCERQTQPGFTHWGSFA
EYVAIENADVNLVALPEEMTFPTAASLGCRFATAFRAVVTVGRVRPGEWVAVHGCGGVGL
SAVMIAAAAGARVVAVDVSPQALDLARRFGAAACVTAAAPAAAPGAADVPPGGAGVAARV
LELTGGGAHVSIDALGSPQTCASSIEGLRRRGRHVQIGLLPGLTSLPMNRVIGYELELLG
SHGMAAHAYPAMLEMVAAGLLRPDLLITRTVGLDGAGPALAAIGSVPGVTMILPGGPEGP
RRP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcggtggtcttcgacgccttcgggtcagatctgcgggtgtgcgaggtgcccgct
cccgcgccgccgcccggcggggcggtgatccgggtggaggcgaccgggctgtgccggagc
gactggcacggctggcagggccacgacccggacatccgggtcctgccgcacgttcccggg
cacgagctggcgggggtcgtcgaggacgtggggccgggggtgggctcgtggcgggccggt
gaccgggtgacggtcccgttcgtctgcgcctgtggttcctgtacggcgtgcgcggccggc
gaccagcaggtctgcgagcgccagacccagccgggcttcacccactggggctccttcgcc
gagtacgtggcgatcgagaacgcggatgtgaacctggtggcgctgccggaggagatgacc
ttccccaccgccgcgagcctgggctgccgcttcgccaccgccttccgcgccgtcgtgacg
gtcggccgggtacggcccggcgagtgggtggcggtgcacggctgcggcggggtcggcctg
tccgccgtgatgatcgccgccgccgcgggcgcacgggtggtcgccgtggacgtctccccc
caggccctggacctggcccggcggttcggcgccgccgcctgcgtcaccgccgccgctccg
gccgccgctcccggcgccgctgacgtcccgccgggcggggccggtgtcgccgcacgcgtc
ctggagctgaccggcggcggggcccacgtctcgatcgacgccctgggcagcccgcagacg
tgcgcgtcgtcgatcgagggcctgcgccgccggggccggcacgtccagatcggcctgctg
ccgggcctcacctcgctgccgatgaaccgggtgatcggctacgagctcgaactcctcggc
agccacggcatggccgcccacgcctatcccgcgatgctggagatggtcgccgccggcctc
ctccgcccggacctgctgatcacccgcaccgtcggcctcgacggagcgggacccgcgctc
gccgcgatcggctccgtgccgggcgtcacgatgatcctgccggggggaccggagggtccc
cgacgcccgtga

DBGET integrated database retrieval system