KEGG   Streptosporangium roseum: Sros_6280Help
Entry
Sros_6280         CDS       T01137                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
sro  Streptosporangium roseum
Pathway
sro00010  Glycolysis / Gluconeogenesis
sro00071  Fatty acid degradation
sro00350  Tyrosine metabolism
sro00625  Chloroalkane and chloroalkene degradation
sro00626  Naphthalene degradation
sro01100  Metabolic pathways
sro01110  Biosynthesis of secondary metabolites
sro01120  Microbial metabolism in diverse environments
sro01130  Biosynthesis of antibiotics
sro01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sros_6280
  Lipid metabolism
   00071 Fatty acid degradation
    Sros_6280
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sros_6280
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sros_6280
   00626 Naphthalene degradation
    Sros_6280
Enzymes [BR:sro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sros_6280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Methyltransf_25 Methyltransf_11 3HCDH_N ADH_zinc_N_2 2-Hacid_dh_C UDPG_MGDP_dh_N Methyltransf_12 MTS
Motif
Other DBs
NCBI-ProteinID: ACZ89005
UniProt: D2AYM2
Position
6890709..6891800
Genome map
AA seq 363 aa AA seqDB search
MRAVVFDAFGSDLRVCEVPAPAPPPGGAVIRVEATGLCRSDWHGWQGHDPDIRVLPHVPG
HELAGVVEDVGPGVGSWRAGDRVTVPFVCACGSCTACAAGDQQVCERQTQPGFTHWGSFA
EYVAIENADVNLVALPEEMTFPTAASLGCRFATAFRAVVTVGRVRPGEWVAVHGCGGVGL
SAVMIAAAAGARVVAVDVSPQALDLARRFGAAACVTAAAPAAAPGAADVPPGGAGVAARV
LELTGGGAHVSIDALGSPQTCASSIEGLRRRGRHVQIGLLPGLTSLPMNRVIGYELELLG
SHGMAAHAYPAMLEMVAAGLLRPDLLITRTVGLDGAGPALAAIGSVPGVTMILPGGPEGP
RRP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcggtggtcttcgacgccttcgggtcagatctgcgggtgtgcgaggtgcccgct
cccgcgccgccgcccggcggggcggtgatccgggtggaggcgaccgggctgtgccggagc
gactggcacggctggcagggccacgacccggacatccgggtcctgccgcacgttcccggg
cacgagctggcgggggtcgtcgaggacgtggggccgggggtgggctcgtggcgggccggt
gaccgggtgacggtcccgttcgtctgcgcctgtggttcctgtacggcgtgcgcggccggc
gaccagcaggtctgcgagcgccagacccagccgggcttcacccactggggctccttcgcc
gagtacgtggcgatcgagaacgcggatgtgaacctggtggcgctgccggaggagatgacc
ttccccaccgccgcgagcctgggctgccgcttcgccaccgccttccgcgccgtcgtgacg
gtcggccgggtacggcccggcgagtgggtggcggtgcacggctgcggcggggtcggcctg
tccgccgtgatgatcgccgccgccgcgggcgcacgggtggtcgccgtggacgtctccccc
caggccctggacctggcccggcggttcggcgccgccgcctgcgtcaccgccgccgctccg
gccgccgctcccggcgccgctgacgtcccgccgggcggggccggtgtcgccgcacgcgtc
ctggagctgaccggcggcggggcccacgtctcgatcgacgccctgggcagcccgcagacg
tgcgcgtcgtcgatcgagggcctgcgccgccggggccggcacgtccagatcggcctgctg
ccgggcctcacctcgctgccgatgaaccgggtgatcggctacgagctcgaactcctcggc
agccacggcatggccgcccacgcctatcccgcgatgctggagatggtcgccgccggcctc
ctccgcccggacctgctgatcacccgcaccgtcggcctcgacggagcgggacccgcgctc
gccgcgatcggctccgtgccgggcgtcacgatgatcctgccggggggaccggagggtccc
cgacgcccgtga

DBGET integrated database retrieval system