KEGG   Streptosporangium roseum: Sros_6500Help
Entry
Sros_6500         CDS       T01137                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sro  Streptosporangium roseum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sro00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7132575..7134491
Genome map
AA seq 638 aa AA seqDB search
MCGIAGMASTSHPDPGLVRRMCDVLVHRGPDGAGFHSDEHAALGMRRLAIIDVATGDQPV
YNEDNRIVAVFNGEIYNFPELRETLISKGHRLRTAGDSECLVHLYEEFGVDLVHHLRGMF
AFAIWDRDRRRLVLARDRVGKKPLYWRSDHASIRFASELKSLTQDPGMDREIDPVALHHY
LTYLYVPAPRSIYQGVHKLPPGHVLVWEGGEITVDRYWRLDRSPRPVTDQRAEEERLREL
LLEATRIRMVSERPLGAFLSGGVDSSAVVAAMAMQSSEPVKTFSIGFEDSRYDERHKARM
VADRYSTDHHELVVTSNLLDTLPRLAWHFDEPFADSSAIPSFYVAQLSRQHVTVALNGDG
GDECFGGYQRYALMDQTRRIPRIPQPFAAVLARTGTLVSERSAPKSLSQRLGRLMGFAAA
HPSQRYARLISYCTPEQKSEIYSDRLRDLLAEVDSYRLLEEVFQASPAETDVGRVLDVDT
LTYLPGDLLAKIDITTMANSLEARSPFLDHHLMEWAAALPSALHVRHGQTKLLLKQAVAP
WLPQQLLRYPKQGFGVPLATWLRGELRELAYDLLTDDTARDRGLFRPAAVRRLLQRHMDG
VDHSVRLWALLQFELWHRTHATPGTWSRDEVRCPLPQP
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggatagccgggatggcttcgacatcgcatccggaccccgggctcgtccgccgc
atgtgtgacgtgctggtgcaccgagggcccgacggtgccggctttcacagtgacgaacac
gcggcactcggcatgcgccggctggcgatcatcgatgtggcgaccggcgaccagcccgtc
tacaacgaggacaaccggatcgtggccgtgttcaacggcgagatctacaacttccccgag
ctccgcgagacgctgatctccaaagggcaccggctgcgcaccgcgggagactccgaatgc
ctcgtgcatctctacgaggagttcggcgtggatctggttcaccacctccgggggatgttc
gctttcgccatctgggaccgggaccgccggcgtctggtcctggccagggacagggtgggc
aagaaaccgctctactggcgctccgaccacgcctcgatccggttcgcctccgagttgaag
tccctcacgcaggacccgggcatggaccgcgagatcgaccccgtcgccctgcaccactac
ctgacgtacctgtacgtccccgcaccgcgctcgatctatcagggcgtgcacaaacttcct
cccgggcatgtgctcgtctgggagggcggcgagatcacggtggaccgctactggcggctg
gaccgctctccccggcccgtgacggaccaacgggcggaggaggagcggctacgtgaactc
ctcctggaggcgacgcggatccgcatggtgagcgagcgcccgctcggagccttcctgtcc
ggcggcgtcgactcctcggccgtggtcgccgccatggcgatgcagagcagtgagccggtc
aagacgttcagcatcggtttcgaggacagccgctacgacgaacgccacaaggcgcggatg
gtcgccgaccggtattccaccgatcatcacgagctcgtggtgacgtcgaaccttctcgac
accctgccgcgcctcgcgtggcacttcgacgagccgttcgccgactcctcggcgattccc
agtttctacgtggcccagctgagccggcagcatgtcaccgtcgcgctcaacggggacggc
ggagacgagtgtttcggcggctaccagcgctacgcgctgatggaccagacccgcaggatt
ccgcgcatcccccagccgttcgcggcagtgctcgcacgcaccggcaccctcgtaagcgag
cggagcgctcctaaatccttgtcccagcggctgggccggctgatggggttcgccgccgcg
catccgtcacagcgttacgcccggctgatctcctactgcacgccggaacagaaatccgag
atctacagcgaccggctccgggacctgctggcggaggtggacagctaccgcctgcttgag
gaggtcttccaagcttcgccggcggaaaccgatgtcggccgtgttctggacgtcgacacg
ctcacctaccttccaggtgacctgctggccaagatcgacattacgacgatggccaactcg
ctggaggcccgctcgccgttcctggaccaccatctgatggagtgggccgcggcccttccc
agcgcactccacgtccgccacggccagaccaagctgttgctcaaacaagcggtggcgccc
tggctgccgcaacagctgctgcgctatcccaagcaggggttcggggtgccgctcgccacc
tggctccgcggtgaactgcgggagctggcctatgacctgctcaccgacgacaccgcgcgc
gacagaggcctgttccggccggcggcggtgcggagactgctccagcggcacatggacggc
gtcgaccacagcgtccggctatgggctctgctgcagttcgagctctggcatcggacgcat
gccacgcctggtacgtggagccgggacgaggtccgatgccccctgccgcagccctga

DBGET integrated database retrieval system