KEGG   Streptosporangium roseum: Sros_6719Help
Entry
Sros_6719         CDS       T01137                                 

Definition
(GenBank) Protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
sro  Streptosporangium roseum
Pathway
sro00860  Porphyrin and chlorophyll metabolism
sro01100  Metabolic pathways
sro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sros_6719
Enzymes [BR:sro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Sros_6719
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Sros_6719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 HI0933_like FAD_binding_2 MCRA Thi4 AlaDh_PNT_C FAD_binding_3 GIDA Trp_halogenase Pyr_redox Lycopene_cycl PspC FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ACZ89428
UniProt: D2B5C3
Position
complement(7392360..7393799)
Genome map
AA seq 479 aa AA seqDB search
MEGNRCHVVVVGGGIAGLAAAWYLRQGGEGVRVTVLDGARRVGGKLLATEVAGVSADAGA
EAMLARRPEGKELARMVGLGEELRHPGTTQAAILSRGALRPMPKGHVMGVPSDLASLARS
GILSPGGLARVPLDQILPATLVGTDVSVAAYIRARMGGEVVERLIEPLLGGVYAGKADRL
SLDATMPRIAIAARSERSLLAATREIAAEAPKDAGPVFTTLRRGMGSLPEAVAAASGAEI
RTGVMVREMRRTESGWQLVAGPVPEPEVIEADAVIVATPGPSASRLLAGEAPLAAAELAR
IDYASMAIVTLAYPREAFPRPPDGSGYLVPPVDGRPIKAATFSSVKWPHLAEADPNLILL
RCSIGRLGEEAVLQRDDAELVALAMAEMVEVMGVRGLPRDSRVTRWGGSLPQYDVGHLDR
VARIRAAVAAQPGLALCGAAYDGVGIPACVSTARTAAARILDHLDPTGEWQKRADSLTS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcaaccggtgccatgtggtggtcgtcggcggcgggatcgcggggctggccgcc
gcgtggtacctgcgacagggcggcgaaggtgtccgggtgaccgtgctagacggcgcccgg
cgggtcggcggcaagcttctggccaccgaggtcgcgggggtctcggcggacgccggggcc
gaggcgatgctcgcgcggcggcccgagggcaaggaactggcccggatggtcggcctgggc
gaggagttacggcatcccggcaccacccaggcggccatcctgtcccggggcgcgctgcgg
cccatgcccaagggacacgtcatgggcgtcccgtccgacctggcctcgctggccaggtcc
ggcatcctcagccccggcggcctcgcccgcgtgcccctggaccagatcctgcccgccacg
ctcgtcggcaccgacgtgtcggtggccgcctacatccgcgcccggatgggcggcgaggtg
gtcgagcgcctgatcgagccgctgctcggcggcgtctacgccggcaaggccgacaggctc
tcgctggacgccacgatgccgaggatcgccatcgcggcccgttccgagcggtcgctgctc
gccgccacccgggagatcgccgccgaggcgcccaaggacgccgggcccgtcttcaccacc
ctgcggcgcgggatgggcagcctgcccgaggccgtggccgcggcctccggcgcggagatc
aggaccggcgtcatggtccgggagatgcgccggaccgagagcggctggcagctggtggcc
gggccggtgcccgagcccgaggtcatcgaggccgacgcggtgatcgtcgccaccccgggg
ccgtcggcgagccgcctgctcgccggtgaggcgcctctggccgccgcggagctggccagg
atcgactacgccagcatggccatcgtcaccctcgcctacccgcgggaggcgttcccccgg
ccgccggacggcagcggctacctcgtgccgcccgtcgacgggcgcccgatcaaggccgcc
acgttcagctcggtcaagtggccgcacctggccgaggccgaccccaacctgatcctgctg
cggtgctcgatcggccgcctcggggaggaggcggtgctccagcgcgacgacgccgagctg
gtcgcgctggcgatggccgagatggtcgaggtcatgggggtgcgcgggctgccgcgcgac
tcccgggtgacccgatggggcggctccctgccgcagtacgacgtgggtcacctcgaccgg
gtcgcccgcatccgcgccgccgtcgcggcccagccgggtctggccctgtgcggcgccgcc
tacgacggcgtcggcatcccggcctgcgtctccaccgcccgcaccgcggcggcccggatt
ctggaccacctggaccccacgggagaatggcagaagagagccgattcgctgacgagctga

DBGET integrated database retrieval system