KEGG   Streptosporangium roseum: Sros_6795Help
Entry
Sros_6795         CDS       T01137                                 

Definition
protein-L-isoaspartate(D-aspartate)O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sro  Streptosporangium roseum
Brite
Enzymes [BR:sro01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Sros_6795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7487196..7488368
Genome map
AA seq 390 aa AA seqDB search
MTEWHDLREDLVAQVCERGISQAVADALRAVPRHVFLPEVPVHAVYQDDAIVTKRDAEGR
PISSSSQPAMMALMLDQLGVEPGQRVLEIGSGTGYNAALLSRLVGPEGQVVSVDIDADLV
ARARDHLERAGYPEVIVVCGDGAEGFALRAPYDRVIATVGVWDLAPAWLDQLGPGGRIVA
PLDLHGVQRSVALERAGGHWRSRSVVPCGFMRMRGPSAGPETTRVLDAGTDLTISLPEGG
EIGDLVAALDGPATELFTEVNSGLAQLVDGLSLWLAVREPRWCTLSETQPGWLASGPLDL
RGFKMVIGIVEGDSLCVLESEAYDTLVARAFGPDAARLAAELAAHIGAWDRAGRPMTDGL
RIDAHVGAVPVGGLVIRKRHTTLALSWDTG
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtggcatgacctgcgggaggacctggtcgcacaggtgtgcgagcgcgggatc
agccaggccgtggccgacgcgttgcgggcggtgccccggcacgtgttcctgccggaggtc
ccggtgcacgccgtgtaccaggacgacgccatcgtgaccaagcgcgacgcggagggccgg
ccgatcagctcgtcgtcacagccggcgatgatggccctgatgctcgaccagctcggcgtg
gagccgggccagcgggtgctggagatcgggtcggggacgggctacaacgccgcgctgctg
tcccgcctggtggggccggagggccaggtcgtgagcgtcgacatcgacgccgacctggtc
gcacgggcccgggaccacctggagagggccgggtatcccgaggtgatcgtggtgtgcggg
gacggcgcggaggggttcgcgctgcgggccccctacgaccgggtgatcgccaccgtcggg
gtgtgggatctggccccggcctggctggaccagctcggccccggcgggcgcatcgtcgcc
ccgctggatctgcacggggtgcagcgctcggtggccctggagcgggcgggcgggcactgg
cggagccgctcggtggtgccctgcgggttcatgcggatgcgaggtccctccgccggcccg
gagacgacccgggtgctggacgccggaacggacctcacgatctcgctgccggaggggggc
gagatcggcgaccttgtggcggcgctcgacggcccggccaccgagctgttcaccgaggtg
aacagcggcctcgcgcagctcgtcgacgggctgagcctgtggctggcggtgcgtgaaccc
cgctggtgcaccctgtcggagacacagcccggatggctggcgtcgggccccctcgatctg
cgaggcttcaagatggtcatcggcatcgtcgagggcgacagcctctgcgtgctggagtcg
gaagcgtacgacaccctggtcgcgcgggccttcggacccgatgcggccaggctggccgcc
gaactcgccgcccacatcggggcatgggacagggcgggacgtccgatgacggacggactg
cgcatcgacgcccatgtcggcgccgtgcccgtcggcgggctggtcatccgtaaacggcac
accacgctcgccctgtcctgggacaccggctga

DBGET integrated database retrieval system